Clone BO15860 Report

Search the DGRC for BO15860

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:158
Well:60
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO15860.pep: validated full length
Sequenced Size:211

Clone Sequence Records

BO15860.3prime Sequence

209 bp (209 high quality bases) assembled on 2006-06-02

> BO15860.3prime
ATGGTCTAGAAAGCTTGCTCCGCCACAATGCGAGCCAGCCTCGCCTCGAT
CTGACACCACTTTTCGAAGAGCAAGCAGCCGTCTGCGTGGCGCTCGTCTA
CCAGGGCCATTGTCGGGTTGTCCTGGATCAACTCCTTGTACTTCCAGGCC
TAAATAGACAGATGCATCTGCATCTCCGTTTGTGATTCTTCCCATGTCGA
CTGATAACT

BO15860.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31032-PA 180 CG31032-RA 1..177 195..19 885 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-10 22:05:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29859331..29859507 19..195 885 100 Plus
Blast to na_te.dros performed on 2015-02-10 22:05:12 has no hits.

BO15860.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:14 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31032-PA 1..180 18..195 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:31 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31032-PA 1..180 18..195 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:55:52 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 29859331..29859505 19..193 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:55:52 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 29859331..29859505 19..193 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 07:42:37 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685053..25685227 19..193 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 07:42:37 Download gff for BO15860.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685053..25685227 19..193 100 -> Plus

BO15860.5prime Sequence

209 bp (209 high quality bases) assembled on 2006-05-30

> BO15860.5prime
GAAGTTATCAGTCGACATGGGAAGAATCACAAACGGAGATGCAGATGCAT
CTGTCTATTTAGGCCTGGAAGTACAAGGAGTTGATCCAGGACAACCCGAC
AATGGCCCTGGTAGACGAGCGCCACGCAGACGGCTGCTTGCTCTTCGAAA
AGTGGTGTCAGATCGAGGCGAGGCTGGCTCGCATTGTGGCGGAGCAAGCT
TTCTAGACC

BO15860.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31032-PA 180 CG31032-RA 1..177 17..193 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-12 05:05:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29859331..29859507 193..17 885 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:05:55 has no hits.

BO15860.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:15 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31032-PA 1..180 17..194 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:32 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31032-PA 1..180 17..194 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:29:37 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 29859331..29859505 19..193 100 -> Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:29:37 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 29859331..29859505 19..193 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 02:54:12 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685053..25685227 19..193 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 02:54:12 Download gff for BO15860.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685053..25685227 19..193 100 -> Minus

BO15860.complete Sequence

211 bp (211 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633610

> BO15860.complete
GAAGTTATCAGTCGACATGGGAAGAATCACAAACGGAGATGCAGATGCAT
CTGTCTATTTAGGCCTGGAAGTACAAGGAGTTGATCCAGGACAACCCGAC
AATGGCCCTGGTAGACGAGCGCCACGCAGACGGCTGCTTGCTCTTCGAAA
AGTGGTGTCAGATCGAGGCGAGGCTGGCTCGCATTGTGGCGGAGCAAGCT
TTCTAGACCAT

BO15860.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 15:58:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 15:58:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29859331..29859507 193..17 885 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:58:30 has no hits.

BO15860.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 14:04:38 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 14:04:38 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:15 Download gff for BO15860.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29859329..29859507 17..195 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:15 Download gff for BO15860.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29859329..29859507 17..195 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:51 Download gff for BO15860.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685051..25685229 17..195 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:51 Download gff for BO15860.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25685051..25685229 17..195 98   Minus

BO15860.pep Sequence

Translation from 16 to 211

> BO15860.pep
MGRITNGDADASVYLGLEVQGVDPGQPDNGPGRRAPRRRLLALRKVVSDR
GEAGSHCGGASFLDH
Sequence BO15860.pep has no blast hits.