Clone BO15861 Report

Search the DGRC for BO15861

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:158
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptnAcRbeta-64B-RB
Protein status:BO15861.pep: validated full length
Sequenced Size:226

Clone Sequence Records

BO15861.3prime Sequence

230 bp (227 high quality bases) assembled on 2006-06-02

> BO15861.3prime
ATGGTCTAGAAAGCTTGCAGAAACGGTTAGCAGATTTAACAGAGTTTTTA
GGCCTTCATTTGCATTTCTTTCCTTTACGAGTTACATAACGGCCCTTGCC
CGAAGGGGGGCGTGGCAGTCTTCTTCTTCGTATCCCAAAATACGTACCCA
ACGAAAAGGCCACAAGCACCATGATGCTGCACAACAGCCAGGATTTGCAG
GAAGACTCCATGTCGACTGATAACTTCGTA

BO15861.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG11348-PB 195 nAcRbeta-64B-RB 1..130 211..82 575 97.6 Minus
CG11348-PA 1566 nAcRbeta-64B-RA 1..64 211..148 295 98.4 Minus
CG11348-PB 195 nAcRbeta-64B-RB 131..192 80..19 285 98.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
nAChRbeta1-RB 818 CG11348-RB 240..432 212..19 885 97.4 Minus
nAChRbeta1-RA 2460 CG11348-RA 240..304 212..148 310 98.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4429651..4429843 212..19 860 97.4 Minus
Blast to na_te.dros performed on 2015-02-08 12:46:09 has no hits.

BO15861.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:16 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11348-PB 1..195 18..211 96   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:33 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11348-PB 1..195 18..211 96   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:46:11 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 240..432 19..212 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:50:11 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
nAChRbeta1-RB 240..432 19..212 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:50:11 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 4429651..4429843 19..212 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:46:11 Download gff for BO15861.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4429651..4429843 19..212 97   Minus

BO15861.5prime Sequence

224 bp (224 high quality bases) assembled on 2006-05-30

> BO15861.5prime
GAAGTTATCAGTCGACATGGAGTCTTCCTGCAAATCCTGGCTGTTGTGCA
GCATCCTGGTGCTTGTGGCCTTTTCGTTGGGTACGTATTTTGGGCTACGA
AGAAGAAGACTGCCACGCCCCCTTTCGGGCAAGGGCCGTTATGTAATCGT
AAAGGAAAGAAATGCAAATGAAGGCCTAAAAACTCTGTTAACTCTGCTAA
CCGTTTCTGCAAGCTTTCTAGACC

BO15861.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG11348-PB 195 nAcRbeta-64B-RB 1..192 17..208 960 100 Plus
CG11348-PA 1566 nAcRbeta-64B-RA 1..64 17..80 320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 01:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
nAChRbeta1-RB 818 CG11348-RB 240..432 16..208 965 100 Plus
nAChRbeta1-RA 2460 CG11348-RA 240..304 16..80 325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 01:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4429651..4429843 16..208 965 100 Plus
Blast to na_te.dros performed on 2015-02-04 01:48:50 has no hits.

BO15861.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:17 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11348-PB 1..195 17..209 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:34 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11348-PB 1..195 17..209 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 20:39:50 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 240..432 16..208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 04:17:23 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
nAChRbeta1-RB 240..432 16..208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 04:17:23 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 4429651..4429843 16..208 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 20:39:50 Download gff for BO15861.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4429651..4429843 16..208 100   Plus

BO15861.complete Sequence

226 bp (226 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633611

> BO15861.complete
GAAGTTATCAGTCGACATGGAGTCTTCCTGCAAATCCTGGCTGTTGTGCA
GCATCCTGGTGCTTGTGGCCTTTTCGTTGGGTACGTATTTTGGGCTACGA
AGAAGAAGACTGCCACGCCCCCTTTCGGGCAAGGGCCGTTATGTAATCGT
AAAGGAAAGAAATGCAAATGAAGGCCTAAAAACTCTGTTAACTCTGCTAA
CCGTTTCTGCAAGCTTTCTAGACCAT

BO15861.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
nAChRbeta1-RB 195 CG11348-PB 1..192 17..208 960 100 Plus
nAChRbeta1-RA 1566 CG11348-PA 1..64 17..80 320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
nAChRbeta1-RB 818 CG11348-RB 240..432 16..208 965 100 Plus
nAChRbeta1-RA 2460 CG11348-RA 240..304 16..80 325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4429651..4429843 16..208 965 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:37:09 has no hits.

BO15861.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:45 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 1..195 17..209 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:17 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 211..403 16..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:33:36 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 241..432 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:45 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
nAcRbeta-64B-RB 211..403 16..208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:04:40 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
nAChRbeta1-RB 241..432 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:04:40 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4429652..4429843 17..210 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:33:36 Download gff for BO15861.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4429652..4429843 17..210 98   Plus

BO15861.pep Sequence

Translation from 16 to 226

> BO15861.pep
MESSCKSWLLCSILVLVAFSLGTYFGLRRRRLPRPLSGKGRYVIVKERNA
NEGLKTLLTLLTVSASFLDH

BO15861.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
nAChRbeta1-PB 64 CG11348-PB 1..64 1..64 322 100 Plus