Clone Sequence Records
BO15861.3prime Sequence
230 bp (227 high quality bases) assembled on 2006-06-02
> BO15861.3prime
ATGGTCTAGAAAGCTTGCAGAAACGGTTAGCAGATTTAACAGAGTTTTTA
GGCCTTCATTTGCATTTCTTTCCTTTACGAGTTACATAACGGCCCTTGCC
CGAAGGGGGGCGTGGCAGTCTTCTTCTTCGTATCCCAAAATACGTACCCA
ACGAAAAGGCCACAAGCACCATGATGCTGCACAACAGCCAGGATTTGCAG
GAAGACTCCATGTCGACTGATAACTTCGTA
BO15861.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11348-PB | 195 | nAcRbeta-64B-RB | 1..130 | 211..82 | 575 | 97.6 | Minus |
CG11348-PA | 1566 | nAcRbeta-64B-RA | 1..64 | 211..148 | 295 | 98.4 | Minus |
CG11348-PB | 195 | nAcRbeta-64B-RB | 131..192 | 80..19 | 285 | 98.3 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:46:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nAChRbeta1-RB | 818 | CG11348-RB | 240..432 | 212..19 | 885 | 97.4 | Minus |
nAChRbeta1-RA | 2460 | CG11348-RA | 240..304 | 212..148 | 310 | 98.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:46:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4429651..4429843 | 212..19 | 860 | 97.4 | Minus |
Blast to na_te.dros performed on 2015-02-08 12:46:09 has no hits.
BO15861.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:16 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11348-PB | 1..195 | 18..211 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:33 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11348-PB | 1..195 | 18..211 | 96 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:46:11 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 240..432 | 19..212 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:50:11 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAChRbeta1-RB | 240..432 | 19..212 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:50:11 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4429651..4429843 | 19..212 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:46:11 Download gff for
BO15861.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4429651..4429843 | 19..212 | 97 | | Minus |
BO15861.5prime Sequence
224 bp (224 high quality bases) assembled on 2006-05-30
> BO15861.5prime
GAAGTTATCAGTCGACATGGAGTCTTCCTGCAAATCCTGGCTGTTGTGCA
GCATCCTGGTGCTTGTGGCCTTTTCGTTGGGTACGTATTTTGGGCTACGA
AGAAGAAGACTGCCACGCCCCCTTTCGGGCAAGGGCCGTTATGTAATCGT
AAAGGAAAGAAATGCAAATGAAGGCCTAAAAACTCTGTTAACTCTGCTAA
CCGTTTCTGCAAGCTTTCTAGACC
BO15861.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11348-PB | 195 | nAcRbeta-64B-RB | 1..192 | 17..208 | 960 | 100 | Plus |
CG11348-PA | 1566 | nAcRbeta-64B-RA | 1..64 | 17..80 | 320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 01:48:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nAChRbeta1-RB | 818 | CG11348-RB | 240..432 | 16..208 | 965 | 100 | Plus |
nAChRbeta1-RA | 2460 | CG11348-RA | 240..304 | 16..80 | 325 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 01:48:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4429651..4429843 | 16..208 | 965 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-04 01:48:50 has no hits.
BO15861.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:17 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11348-PB | 1..195 | 17..209 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:34 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11348-PB | 1..195 | 17..209 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 20:39:50 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 240..432 | 16..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 04:17:23 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAChRbeta1-RB | 240..432 | 16..208 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 04:17:23 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4429651..4429843 | 16..208 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 20:39:50 Download gff for
BO15861.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4429651..4429843 | 16..208 | 100 | | Plus |
BO15861.complete Sequence
226 bp (226 high quality bases) assembled on 2006-08-24
GenBank Submission: FJ633611
> BO15861.complete
GAAGTTATCAGTCGACATGGAGTCTTCCTGCAAATCCTGGCTGTTGTGCA
GCATCCTGGTGCTTGTGGCCTTTTCGTTGGGTACGTATTTTGGGCTACGA
AGAAGAAGACTGCCACGCCCCCTTTCGGGCAAGGGCCGTTATGTAATCGT
AAAGGAAAGAAATGCAAATGAAGGCCTAAAAACTCTGTTAACTCTGCTAA
CCGTTTCTGCAAGCTTTCTAGACCAT
BO15861.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:37:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nAChRbeta1-RB | 195 | CG11348-PB | 1..192 | 17..208 | 960 | 100 | Plus |
nAChRbeta1-RA | 1566 | CG11348-PA | 1..64 | 17..80 | 320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:37:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nAChRbeta1-RB | 818 | CG11348-RB | 240..432 | 16..208 | 965 | 100 | Plus |
nAChRbeta1-RA | 2460 | CG11348-RA | 240..304 | 16..80 | 325 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:37:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4429651..4429843 | 16..208 | 965 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 23:37:09 has no hits.
BO15861.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:45 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 1..195 | 17..209 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:17 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 211..403 | 16..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:33:36 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 241..432 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:45 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAcRbeta-64B-RB | 211..403 | 16..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:04:40 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
nAChRbeta1-RB | 241..432 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:04:40 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4429652..4429843 | 17..210 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:33:36 Download gff for
BO15861.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4429652..4429843 | 17..210 | 98 | | Plus |
BO15861.pep Sequence
Translation from 16 to 226
> BO15861.pep
MESSCKSWLLCSILVLVAFSLGTYFGLRRRRLPRPLSGKGRYVIVKERNA
NEGLKTLLTLLTVSASFLDH
BO15861.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nAChRbeta1-PB | 64 | CG11348-PB | 1..64 | 1..64 | 322 | 100 | Plus |