Clone BO15910 Report

Search the DGRC for BO15910

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:159
Well:10
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO15910.pep: validated full length
Sequenced Size:394

Clone Sequence Records

BO15910.3prime Sequence

392 bp (392 high quality bases) assembled on 2006-06-02

> BO15910.3prime
ATGGTCTAGAAAGCTTGCCCCTGGTCCATACAAAACTATTAGGCAGAGGT
TTGGCAAAGGTATGCGCAGCACCATTTCCTCAAAAGTTGCAAATTGGTCA
TCTGTCAGTAGAGGCGCCAATAGTTCATCTTCGTAGCTGGCCACCAAGTC
CAAGTTGTACTTGCCCGGTTGTTGAACTTCGTAGGGCATCAAAGAGAGCA
CTGATTCGCCGAGGCAGCTCTTTGCTACCTGAAAGTCCTGTTCGCAGCTC
AAGCAGGTGCGCACGCCCATACAACCGCAACTATGAATTGTATTCATCCT
GGGGTTGTACTGATTTGTCATTCTCCATTTCTGCATCGTCATCGGACTCC
GAATCCATTTCAGCAGCATTCTTGCCATGTCGACTGATAACT

BO15910.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18854-PC 363 CG18854-RC 1..360 378..19 1800 100 Minus
CG18854-PA 282 CG18854-RA 1..279 297..19 1395 100 Minus
CG18854-PB 282 CG18854-RB 1..279 297..19 1395 100 Minus
CG4036-PA 915 CG4036-RA 558..749 217..26 660 93.7 Minus
CG4036-PA 915 CG4036-RA 18..68 280..230 205 96 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 950 CG4036-RB 579..775 217..21 790 93.4 Minus
CG4036-RA 1002 CG4036-RA 631..827 217..21 790 93.4 Minus
CG4036-RA 1002 CG4036-RA 70..152 301..219 295 90.4 Minus
CG4036-RB 950 CG4036-RB 20..100 299..219 285 90.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9789367..9789617 50..300 1255 100 Plus
2L 23513712 2L 9791527..9791694 217..50 705 94.6 Minus
2L 23513712 2L 9789790..9789870 298..378 405 100 Plus
2L 23513712 2L 9790966..9791048 301..219 295 90.4 Minus
2L 23513712 2L 9790662..9790709 362..315 180 91.7 Minus
Blast to na_te.dros performed on 2015-02-12 11:38:36 has no hits.

BO15910.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:56:18 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18854-PC 1..363 16..378 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:01:57 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18854-PC 1..363 16..378 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 01:05:32 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 21..216 93   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:53:21 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 21..216 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:53:21 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9789367..9789615 50..298 100 <- Plus
2L 9789791..9789883 299..390 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 01:05:32 Download gff for BO15910.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9789367..9789615 50..298 100 <- Plus
arm_2L 9789791..9789883 299..390 95   Plus

BO15910.5prime Sequence

392 bp (392 high quality bases) assembled on 2006-06-02

> BO15910.5prime
GAAGTTATCAGTCGACATGGCAAGAATGCTGCTGAAATGGATTCGGAGTC
CGATGACGATGCAGAAATGGAGAATGACAAATCAGTACAACCCCAGGATG
AATACAATTCATAGTTGCGGTTGTATGGGCGTGCGCACCTGCTTGAGCTG
CGAACAGGACTTTCAGGTAGCAAAGAGCTGCCTCGGCGAATCAGTGCTCT
CTTTGATGCCCTACGAAGTTCAACAACCGGGCAAGTACAACTTGGACTTG
GTGGCCAGCTACGAAGATGAACTATTGGCGCCTCTACTGACAGATGACCA
ATTTGCAACTTTTGAGGAAATGGTGCTGCGCATACCTTTGCCAAACCTCT
GCCTAATAGTTTTGTATGGACCAGGGGCAAGCTTTCTAGACC

BO15910.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18854-PC 363 CG18854-RC 1..360 17..376 1800 100 Plus
CG18854-PA 282 CG18854-RA 1..279 98..376 1395 100 Plus
CG18854-PB 282 CG18854-RB 1..279 98..376 1395 100 Plus
CG4036-PA 915 CG4036-RA 558..749 178..369 660 93.7 Plus
CG4036-PA 915 CG4036-RA 18..68 115..165 205 96 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 10:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 950 CG4036-RB 579..775 178..374 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 631..827 178..374 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 70..152 94..176 295 90.4 Plus
CG4036-RB 950 CG4036-RB 20..100 96..176 285 90.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 10:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9789367..9789617 345..95 1255 100 Minus
2L 23513712 2L 9791527..9791694 178..345 705 94.6 Plus
2L 23513712 2L 9789790..9789870 97..17 405 100 Minus
2L 23513712 2L 9790966..9791048 94..176 295 90.4 Plus
2L 23513712 2L 9790662..9790709 33..80 180 91.7 Plus
Blast to na_te.dros performed on 2015-02-09 10:53:00 has no hits.

BO15910.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:56:19 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18854-PC 1..363 17..379 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:01:58 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18854-PC 1..363 17..379 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 16:38:44 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 179..374 93   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 11:40:23 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 179..374 93   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 11:40:23 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9789367..9789615 97..345 100 <- Minus
2L 9789791..9789883 5..96 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 16:38:44 Download gff for BO15910.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9789367..9789615 97..345 100 <- Minus
arm_2L 9789791..9789883 5..96 95   Minus

BO15910.complete Sequence

394 bp (394 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633624

> BO15910.complete
GAAGTTATCAGTCGACATGGCAAGAATGCTGCTGAAATGGATTCGGAGTC
CGATGACGATGCAGAAATGGAGAATGACAAATCAGTACAACCCCAGGATG
AATACAATTCATAGTTGCGGTTGTATGGGCGTGCGCACCTGCTTGAGCTG
CGAACAGGACTTTCAGGTAGCAAAGAGCTGCCTCGGCGAATCAGTGCTCT
CTTTGATGCCCTACGAAGTTCAACAACCGGGCAAGTACAACTTGGACTTG
GTGGCCAGCTACGAAGATGAACTATTGGCGCCTCTACTGACAGATGACCA
ATTTGCAACTTTTGAGGAAATGGTGCTGCGCATACCTTTGCCAAACCTCT
GCCTAATAGTTTTGTATGGACCAGGGGCAAGCTTTCTAGACCAT

BO15910.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 915 CG4036-PB 558..754 178..374 790 93.4 Plus
CG4036-RA 915 CG4036-PA 558..754 178..374 790 93.4 Plus
CG4036-RB 915 CG4036-PB 1..79 98..176 275 89.9 Plus
CG4036-RA 915 CG4036-PA 1..79 98..176 275 89.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 950 CG4036-RB 579..775 178..374 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 631..827 178..374 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 70..152 94..176 295 90.4 Plus
CG4036-RB 950 CG4036-RB 20..100 96..176 285 90.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9789367..9789617 345..95 1255 100 Minus
2L 23513712 2L 9791527..9791694 178..345 705 94.6 Plus
2L 23513712 2L 9789790..9789870 97..17 405 100 Minus
2L 23513712 2L 9790966..9791048 94..176 295 90.4 Plus
2L 23513712 2L 9790662..9790709 33..80 180 91.7 Plus
Blast to na_te.dros performed on 2014-11-27 23:52:29 has no hits.

BO15910.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:52:00 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18854-RC 1..363 17..379 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:07:39 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18854-RC 557..942 5..385 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:40:25 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 179..374 93   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:52:00 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
CG18854-RC 557..942 5..385 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:10:04 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 179..374 93   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:10:04 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9789273..9789306 346..378 94 <- Minus
2L 9789367..9789615 97..345 100 <- Minus
2L 9789791..9789870 17..96 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:40:25 Download gff for BO15910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9789273..9789306 346..378 94 <- Minus
arm_2L 9789367..9789615 97..345 100 <- Minus
arm_2L 9789791..9789870 17..96 100   Minus

BO15910.pep Sequence

Translation from 16 to 394

> BO15910.pep
MARMLLKWIRSPMTMQKWRMTNQYNPRMNTIHSCGCMGVRTCLSCEQDFQ
VAKSCLGESVLSLMPYEVQQPGKYNLDLVASYEDELLAPLLTDDQFATFE
EMVLRIPLPNLCLIVLYGPGASFLDH

BO15910.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-PB 304 CG4036-PB 183..258 51..126 293 76.3 Plus
CG4036-PA 304 CG4036-PA 183..258 51..126 293 76.3 Plus