Clone BO15948 Report

Search the DGRC for BO15948

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:159
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptTim8-RA
Protein status:BO15948.pep: validated full length
Sequenced Size:298

Clone Sequence Records

BO15948.3prime Sequence

296 bp (296 high quality bases) assembled on 2006-06-02

> BO15948.3prime
ATGGTCTAGAAAGCTTGCCAGGTCGCCGCCACCTCGCTTTTGGAGCATCT
GAGCGAACCGCTGGGTGATAAGCAGCGACGTGTCGATGAATCGGTCGACG
CAGTTGCTCAGGCACGTCTCGGTGGCGTGGTCCAGCTTGGTACTCGGCTT
GCCGATGCACTTCTCCCAGCAGATCTCGTTGAACTCGTGTATCTGCGCGT
TGACCTGTGCCTTCTGTTTCTCAATCAAGAGGAACTCCTGCAGCTCCTTG
TCATTGCCGGAAAGGTTCTCAAAATCGGACATGTCGACTGATAACT

BO15948.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG1728-PA 267 Tim8-RA 1..264 282..19 1320 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 18:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-RB 761 CG1728-RB 92..355 282..19 1320 100 Minus
Tim8-RA 661 CG1728-RA 92..355 282..19 1320 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 18:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11368701..11368877 195..19 885 100 Minus
X 23542271 X 11368536..11368625 282..193 450 100 Minus
Blast to na_te.dros performed 2015-01-30 18:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 3256..3287 178..147 106 81.2 Minus

BO15948.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:56:39 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-PA 1..267 18..282 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:02:24 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1728-PA 1..267 18..282 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:59:49 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 84..362 10..292 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:12:54 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 84..362 10..292 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:12:54 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
X 11368528..11368625 193..292 96 -> Minus
X 11368704..11368884 10..192 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:59:49 Download gff for BO15948.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11262561..11262658 193..292 96 -> Minus
arm_X 11262737..11262917 10..192 97   Minus

BO15948.5prime Sequence

296 bp (296 high quality bases) assembled on 2006-06-02

> BO15948.5prime
GAAGTTATCAGTCGACATGTCCGATTTTGAGAACCTTTCCGGCAATGACA
AGGAGCTGCAGGAGTTCCTCTTGATTGAGAAACAGAAGGCACAGGTCAAC
GCGCAGATACACGAGTTCAACGAGATCTGCTGGGAGAAGTGCATCGGCAA
GCCGAGTACCAAGCTGGACCACGCCACCGAGACGTGCCTGAGCAACTGCG
TCGACCGATTCATCGACACGTCGCTGCTTATCACCCAGCGGTTCGCTCAG
ATGCTCCAAAAGCGAGGTGGCGGCGACCTGGCAAGCTTTCTAGACC

BO15948.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG1728-PA 267 Tim8-RA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-RB 761 CG1728-RB 92..355 17..280 1320 100 Plus
Tim8-RA 661 CG1728-RA 92..355 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11368701..11368877 104..280 885 100 Plus
X 23542271 X 11368536..11368625 17..106 450 100 Plus
Blast to na_te.dros performed 2015-02-11 10:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 3256..3287 121..152 106 81.2 Plus

BO15948.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:56:40 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-PA 1..267 17..281 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:02:25 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1728-PA 1..267 17..281 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 15:10:12 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 84..362 7..289 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:21:13 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 84..362 7..289 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:21:13 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11368528..11368625 7..106 96 -> Plus
X 11368704..11368884 107..289 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 15:10:12 Download gff for BO15948.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11262561..11262658 7..106 96 -> Plus
arm_X 11262737..11262917 107..289 97   Plus

BO15948.complete Sequence

298 bp (298 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633637

> BO15948.complete
GAAGTTATCAGTCGACATGTCCGATTTTGAGAACCTTTCCGGCAATGACA
AGGAGCTGCAGGAGTTCCTCTTGATTGAGAAACAGAAGGCACAGGTCAAC
GCGCAGATACACGAGTTCAACGAGATCTGCTGGGAGAAGTGCATCGGCAA
GCCGAGTACCAAGCTGGACCACGCCACCGAGACGTGCCTGAGCAACTGCG
TCGACCGATTCATCGACACGTCGCTGCTTATCACCCAGCGGTTCGCTCAG
ATGCTCCAAAAGCGAGGTGGCGGCGACCTGGCAAGCTTTCTAGACCAT

BO15948.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-RB 267 CG1728-PB 1..264 17..280 1320 100 Plus
Tim8-RA 267 CG1728-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-RB 761 CG1728-RB 92..355 17..280 1320 100 Plus
Tim8-RA 661 CG1728-RA 92..355 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11368701..11368877 104..280 885 100 Plus
X 23542271 X 11368536..11368625 17..106 450 100 Plus
Blast to na_te.dros performed 2014-11-27 14:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 3256..3287 121..152 106 81.2 Plus

BO15948.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:53:54 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 17..281 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:26:07 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 68..346 7..289 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:56 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 92..355 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:53:54 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 68..346 7..289 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:08 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 92..355 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:08 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
X 11368704..11368877 107..282 98   Plus
X 11368536..11368625 17..106 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:56 Download gff for BO15948.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11262569..11262658 17..106 100 -> Plus
arm_X 11262737..11262910 107..282 98   Plus

BO15948.pep Sequence

Translation from 16 to 298

> BO15948.pep
MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKL
DHATETCLSNCVDRFIDTSLLITQRFAQMLQKRGGGDLASFLDH

BO15948.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-PB 88 CG1728-PB 1..88 1..88 464 100 Plus
Tim8-PA 88 CG1728-PA 1..88 1..88 464 100 Plus
CG34132-PA 84 CG34132-PA 15..79 20..82 135 38.5 Plus