Clone BO15962 Report

Search the DGRC for BO15962

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:159
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG31517-RA
Protein status:BO15962.pep: validated full length
Sequenced Size:223

Clone Sequence Records

BO15962.3prime Sequence

221 bp (221 high quality bases) assembled on 2006-06-02

> BO15962.3prime
ATGGTCTAGAAAGCTTGCACGTTGTCCTGCGTTGCTCTGCGGTCTCATTC
CCGTCGACGATCCCCGTCCTGGGCCGTAAAATGTCAAATTAATGTTACAA
CATGTCCAGCGATTTCTGATGGCATTTGACAATGTCGAGTGGAAATTCCT
GCAGGTGACGCAATTTCCCTGTAATTTGTTTGGCCGCACGTACCGTCGCC
ACGACATGTCGACTGATAACT

BO15962.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PA 192 CG31517-RA 1..189 207..19 945 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..604 208..19 950 100 Minus
CG31517-RA 827 CG31517-RA 415..604 208..19 950 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 07:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 208..44 825 100 Minus
Blast to na_te.dros performed on 2015-02-03 07:14:39 has no hits.

BO15962.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:01 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 15..207 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:02:53 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 15..207 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:36:55 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..592 15..208 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:43:03 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 415..607 15..208 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:43:03 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13948834..13948998 44..208 100 -> Minus
3R 13949083..13949110 15..43 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:36:55 Download gff for BO15962.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774556..9774720 44..208 100 -> Minus
arm_3R 9774805..9774832 15..43 93   Minus

BO15962.5prime Sequence

221 bp (221 high quality bases) assembled on 2006-06-02

> BO15962.5prime
GAAGTTATCAGTCGACATGTCGTGGCGACGGTACGTGCGGCCAAACAAAT
TACAGGGAAATTGCGTCACCTGCAGGAATTTCCACTCGACATTGTCAAAT
GCCATCAGAAATCGCTGGACATGTTGTAACATTAATTTGACATTTTACGG
CCCAGGACGGGGATCGTCGACGGGAATGAGACCGCAGAGCAACGCAGGAC
AACGTGCAAGCTTTCTAGACC

BO15962.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PA 192 CG31517-RA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..604 16..205 950 100 Plus
CG31517-RA 827 CG31517-RA 415..604 16..205 950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 16..180 825 100 Plus
Blast to na_te.dros performed on 2015-02-12 00:08:57 has no hits.

BO15962.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:02 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..209 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:02:54 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..209 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 19:57:18 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..592 16..209 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:56:19 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 415..607 16..209 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:56:19 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13948834..13948998 16..180 100 -> Plus
3R 13949083..13949110 181..209 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 19:57:18 Download gff for BO15962.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774556..9774720 16..180 100 -> Plus
arm_3R 9774805..9774832 181..209 93   Plus

BO15962.complete Sequence

223 bp (223 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633641

> BO15962.complete
GAAGTTATCAGTCGACATGTCGTGGCGACGGTACGTGCGGCCAAACAAAT
TACAGGGAAATTGCGTCACCTGCAGGAATTTCCACTCGACATTGTCAAAT
GCCATCAGAAATCGCTGGACATGTTGTAACATTAATTTGACATTTTACGG
CCCAGGACGGGGATCGTCGACGGGAATGAGACCGCAGAGCAACGCAGGAC
AACGTGCAAGCTTTCTAGACCAT

BO15962.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 192 CG31517-PB 1..189 17..205 945 100 Plus
CG31517-RA 192 CG31517-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..604 16..205 950 100 Plus
CG31517-RA 827 CG31517-RA 415..604 16..205 950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 16..180 825 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:35:24 has no hits.

BO15962.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:51:41 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 17..209 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:07:14 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..592 16..209 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:27:36 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 401..589 17..207 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:51:41 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..592 16..209 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:34:30 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 416..604 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:34:30 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13948835..13948998 17..180 100 -> Plus
3R 13949083..13949107 181..207 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:27:36 Download gff for BO15962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774557..9774720 17..180 100 -> Plus
arm_3R 9774805..9774829 181..207 92   Plus

BO15962.pep Sequence

Translation from 16 to 223

> BO15962.pep
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQRASFLDH

BO15962.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PB 63 CG31517-PB 1..63 1..63 357 100 Plus
CG31517-PA 63 CG31517-PA 1..63 1..63 357 100 Plus