Clone BO15979 Report

Search the DGRC for BO15979

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:159
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG32388-RA
Protein status:BO15979.pep: validated full length
Sequenced Size:271

Clone Sequence Records

BO15979.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-02

> BO15979.3prime
ATGGTCTAGAAAGCTTGCCTTTTTCTTGCACTCATCTTTGGATTTGTCTG
AGCCGCCGGGTTTGTTTTTGCAACGTGGTGAAGTGGGAACAACAGTTCTG
CCACACATATCCTTCTTCTTTTTGTCTTTCTTCTTTTTGGAATCGGCACC
CTTGCAAGAATCCTTGCCCGAATCCTTCGGCGATTTGGCCATTAGTCGTG
CGCCGAAAACGCCTTCACTCAATTTCATGAGCGCCAAGCTGCGCACTTTG
AACATGTCGACTGATAACT

BO15979.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 240 CG32388-RA 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..321 256..19 1190 100 Minus
CG32388-RA 990 CG32388-RA 84..321 256..19 1190 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 96..256 805 100 Plus
3L 28110227 3L 6984203..6984279 19..95 385 100 Plus
Blast to na_te.dros performed 2015-02-10 18:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 122..60 99 61.9 Minus

BO15979.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:29 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 18..255 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:03:33 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 18..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:48:19 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 68..325 13..269 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:54:18 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 68..325 13..269 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:54:18 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6984199..6984279 13..95 96 <- Plus
3L 6984343..6984518 96..269 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:48:19 Download gff for BO15979.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977299..6977379 13..95 96 <- Plus
arm_3L 6977443..6977618 96..269 97   Plus

BO15979.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-02

> BO15979.5prime
GAAGTTATCAGTCGACATGTTCAAAGTGCGCAGCTTGGCGCTCATGAAAT
TGAGTGAAGGCGTTTTCGGCGCACGACTAATGGCCAAATCGCCGAAGGAT
TCGGGCAAGGATTCTTGCAAGGGTGCCGATTCCAAAAAGAAGAAAGACAA
AAAGAAGAAGGATATGTGTGGCAGAACTGTTGTTCCCACTTCACCACGTT
GCAAAAACAAACCCGGCGGCTCAGACAAATCCAAAGATGAGTGCAAGAAA
AAGGCAAGCTTTCTAGACC

BO15979.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 240 CG32388-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 10:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..321 16..253 1190 100 Plus
CG32388-RA 990 CG32388-RA 84..321 16..253 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 10:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 176..16 805 100 Minus
3L 28110227 3L 6984203..6984279 253..177 385 100 Minus
Blast to na_te.dros performed 2015-02-09 10:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 150..212 99 61.9 Plus

BO15979.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:30 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..254 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:03:35 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..254 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 16:39:22 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 67..325 2..259 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 11:40:52 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 67..325 2..259 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 11:40:52 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6984343..6984519 2..176 97   Minus
3L 6984199..6984279 177..259 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 16:39:22 Download gff for BO15979.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977299..6977379 177..259 96 <- Minus
arm_3L 6977443..6977619 2..176 97   Minus

BO15979.complete Sequence

271 bp (271 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633649

> BO15979.complete
GAAGTTATCAGTCGACATGTTCAAAGTGCGCAGCTTGGCGCTCATGAAAT
TGAGTGAAGGCGTTTTCGGCGCACGACTAATGGCCAAATCGCCGAAGGAT
TCGGGCAAGGATTCTTGCAAGGGTGCCGATTCCAAAAAGAAGAAAGACAA
AAAGAAGAAGGATATGTGTGGCAGAACTGTTGTTCCCACTTCACCACGTT
GCAAAAACAAACCCGGCGGCTCAGACAAATCCAAAGATGAGTGCAAGAAA
AAGGCAAGCTTTCTAGACCAT

BO15979.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-RA 240 CG32388-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..321 16..253 1190 100 Plus
CG32388-RA 990 CG32388-RA 84..321 16..253 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 176..16 805 100 Minus
3L 28110227 3L 6984203..6984279 253..177 385 100 Minus
Blast to na_te.dros performed 2014-11-27 14:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 150..212 99 61.9 Plus

BO15979.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:51:47 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 1..240 17..254 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:07:23 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 53..311 2..259 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:09 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 90..321 22..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:51:47 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 53..311 2..259 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:07:05 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 90..321 22..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:07:05 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6984199..6984279 177..255 97 <- Minus
3L 6984343..6984497 22..176 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:09 Download gff for BO15979.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977299..6977379 177..255 97 <- Minus
arm_3L 6977443..6977597 22..176 100   Minus

BO15979.pep Sequence

Translation from 16 to 271

> BO15979.pep
MFKVRSLALMKLSEGVFGARLMAKSPKDSGKDSCKGADSKKKKDKKKKDM
CGRTVVPTSPRCKNKPGGSDKSKDECKKKASFLDH

BO15979.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 79 CG32388-PA 1..79 1..79 415 100 Plus