Clone BO16001 Report

Search the DGRC for BO16001

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG5804-RA
Protein status:BO16001.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO16001.5prime Sequence

278 bp (278 high quality bases) assembled on 2006-06-16

> BO16001.5prime
GAAGTTATCAGTCGACATGGCCGATTTCAACGCTATCCTCGAGAAGACCA
AGGCCTTCAGCAAGAAGCCCCCAACGGAGGTGTACCTGGAGTTCTATGGC
CTGTACAAGCAGTTCCAGGAGGGCGACATTAACATCGAGAAGCCCGCTGA
TGCCGAGGGTGCCGCTAAGTACGATGCCTGGCTGAGCCGCAAGGGACTGT
CCGTCGATGACGCCAAGGCCGCCTACGTCGCCCTGTACGAGAAGTACAAC
CCCATCTACGGAGCAAGCTTTCTAGACC

BO16001.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-PA 249 CG5804-RA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-RA 337 CG5804-RA 32..277 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8788204..8788440 262..26 1185 100 Minus
Blast to na_te.dros performed on 2015-02-12 18:39:02 has no hits.

BO16001.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:27 Download gff for BO16001.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-PA 1..249 17..266 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 01:36:39 Download gff for BO16001.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 26..287 10..275 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:19:32 Download gff for BO16001.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 26..287 10..275 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:19:32 Download gff for BO16001.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8788194..8788440 26..275 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 01:36:39 Download gff for BO16001.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8781294..8781540 26..275 98   Minus

BO16001.3prime Sequence

278 bp (278 high quality bases) assembled on 2006-06-16

> BO16001.3prime
ATGGTCTAGAAAGCTTGCTCCGTAGATGGGGTTGTACTTCTCGTACAGGG
CGACGTAGGCGGCCTTGGCGTCATCGACGGACAGTCCCTTGCGGCTCAGC
CAGGCATCGTACTTAGCGGCACCCTCGGCATCAGCGGGCTTCTCGATGTT
AATGTCGCCCTCCTGGAACTGCTTGTACAGGCCATAGAACTCCAGGTACA
CCTCCGTTGGGGGCTTCTTGCTGAAGGCCTTGGTCTTCTCGAGGATAGCG
TTGAAATCGGCCATGTCGACTGATAACT

BO16001.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-PA 249 CG5804-RA 1..246 264..19 1230 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-RA 337 CG5804-RA 32..277 264..19 1230 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8788204..8788440 19..255 1185 100 Plus
Blast to na_te.dros performed on 2015-02-06 12:12:30 has no hits.

BO16001.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:26 Download gff for BO16001.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-PA 1..249 15..264 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:08:58 Download gff for BO16001.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 26..287 6..271 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:38:28 Download gff for BO16001.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 26..287 6..271 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:38:28 Download gff for BO16001.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8788200..8788440 13..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:08:58 Download gff for BO16001.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8781300..8781540 13..255 98   Plus

BO16001.complete Sequence

280 bp assembled on 2008-08-15

GenBank Submission: FJ633658

> BO16001.complete
GAAGTTATCAGTCGACATGGCCGATTTCAACGCTATCCTCGAGAAGACCA
AGGCCTTCAGCAAGAAGCCCCCAACGGAGGTGTACCTGGAGTTCTATGGC
CTGTACAAGCAGTTCCAGGAGGGCGACATTAACATCGAGAAGCCCGCTGA
TGCCGAGGGTGCCGCTAAGTACGATGCCTGGCTGAGCCGCAAGGGACTGT
CCGTCGATGACGCCAAGGCCGCCTACGTCGCCCTGTACGAGAAGTACAAC
CCCATCTACGGAGCAAGCTTTCTAGACCAT

BO16001.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-RA 249 CG5804-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-RA 337 CG5804-RA 32..277 17..262 1230 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8788204..8788440 262..26 1185 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:38:50 has no hits.

BO16001.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:48:18 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 21..282 10..275 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:52 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 32..277 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:01:35 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 27..272 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:27 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
CG5804-RA 32..277 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:27 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8788202..8788440 26..264 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:52 Download gff for BO16001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8781302..8781540 26..264 99   Minus

BO16001.pep Sequence

Translation from 16 to 280

> BO16001.pep
MADFNAILEKTKAFSKKPPTEVYLEFYGLYKQFQEGDINIEKPADAEGAA
KYDAWLSRKGLSVDDAKAAYVALYEKYNPIYGASFLDH

BO16001.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG5804-PA 82 CG5804-PA 1..82 1..82 430 100 Plus
CG15829-PB 82 CG15829-PB 1..81 1..81 225 53.1 Plus
CG15829-PA 82 CG15829-PA 1..81 1..81 225 53.1 Plus
CG8629-PA 84 CG8629-PA 1..83 1..81 211 53 Plus
CG8628-PA 84 CG8628-PA 1..83 1..81 205 51.8 Plus