Clone BO16003 Report

Search the DGRC for BO16003

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCG8629-RA
Protein status:BO16003.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO16003.3prime Sequence

284 bp (284 high quality bases) assembled on 2006-06-16

> BO16003.3prime
ATGGTCTAGAAAGCTTGCGGCGTACTTGGGGGCATACTTCTCGTACACCT
TCACGTAGGCCTCCTTGGCGGCATCCTTGGAGAGACCCTTGTGGGCGTTC
CAGGCCTCGTACATGGCCTTCTTCTTGAGATCCAGAATGCCGGGCTTGTC
GATGTTCACATCACCAACGGTAGCCTGCTTGAAGAGACCGTAGAACTCCA
GGAACTCGGAGTCGGTGGGCTTCTTGGAGAAGTTCTTGGCGAGTTCGGCG
GCTTCCTCAAAACTGACCATGTCGACTGATAACT

BO16003.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-PA 255 CG8629-RA 1..252 270..19 1260 100 Minus
CG8628-PA 255 CG8628-RA 13..252 258..19 550 89.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 04:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-RA 352 CG8629-RA 36..287 270..19 1260 100 Minus
CG8628-RA 429 CG8628-RA 71..310 258..19 810 89.2 Minus
CG8628-RB 408 CG8628-RB 50..289 258..19 810 89.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 04:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7127978..7128229 19..270 1260 100 Plus
3L 28110227 3L 7131147..7131386 258..19 810 89.2 Minus
Blast to na_te.dros performed on 2015-02-03 04:42:38 has no hits.

BO16003.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:28 Download gff for BO16003.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-PA 1..255 15..270 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:11:01 Download gff for BO16003.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..291 14..270 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:24:25 Download gff for BO16003.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..291 14..270 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:24:25 Download gff for BO16003.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 7127974..7128229 14..270 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:11:01 Download gff for BO16003.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7121074..7121329 14..270 99   Plus

BO16003.5prime Sequence

284 bp (284 high quality bases) assembled on 2006-06-16

> BO16003.5prime
GAAGTTATCAGTCGACATGGTCAGTTTTGAGGAAGCCGCCGAACTCGCCA
AGAACTTCTCCAAGAAGCCCACCGACTCCGAGTTCCTGGAGTTCTACGGT
CTCTTCAAGCAGGCTACCGTTGGTGATGTGAACATCGACAAGCCCGGCAT
TCTGGATCTCAAGAAGAAGGCCATGTACGAGGCCTGGAACGCCCACAAGG
GTCTCTCCAAGGATGCCGCCAAGGAGGCCTACGTGAAGGTGTACGAGAAG
TATGCCCCCAAGTACGCCGCAAGCTTTCTAGACC

BO16003.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-PA 255 CG8629-RA 1..252 17..268 1260 100 Plus
CG8628-PA 255 CG8628-RA 13..252 29..268 550 89.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 06:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-RA 352 CG8629-RA 36..287 17..268 1260 100 Plus
CG8628-RA 429 CG8628-RA 71..310 29..268 810 89.2 Plus
CG8628-RB 408 CG8628-RB 50..289 29..268 810 89.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 06:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7127978..7128229 268..17 1260 100 Minus
3L 28110227 3L 7131147..7131386 29..268 810 89.2 Plus
Blast to na_te.dros performed on 2015-01-31 06:30:28 has no hits.

BO16003.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:28 Download gff for BO16003.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-PA 1..255 17..272 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 22:09:13 Download gff for BO16003.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..291 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 07:41:36 Download gff for BO16003.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..291 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 07:41:36 Download gff for BO16003.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 7127974..7128229 17..273 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 22:09:13 Download gff for BO16003.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7121074..7121329 17..273 99   Minus

BO16003.complete Sequence

286 bp assembled on 2008-08-15

GenBank Submission: FJ633659

> BO16003.complete
GAAGTTATCAGTCGACATGGTCAGTTTTGAGGAAGCCGCCGAACTCGCCA
AGAACTTCTCCAAGAAGCCCACCGACTCCGAGTTCCTGGAGTTCTACGGT
CTCTTCAAGCAGGCTACCGTTGGTGATGTGAACATCGACAAGCCCGGCAT
TCTGGATCTCAAGAAGAAGGCCATGTACGAGGCCTGGAACGCCCACAAGG
GTCTCTCCAAGGATGCCGCCAAGGAGGCCTACGTGAAGGTGTACGAGAAG
TATGCCCCCAAGTACGCCGCAAGCTTTCTAGACCAT

BO16003.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-RA 255 CG8629-PA 1..252 17..268 1260 100 Plus
CG8628-RA 255 CG8628-PA 13..252 29..268 810 89.2 Plus
CG8628-RB 255 CG8628-PB 13..252 29..268 810 89.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-RA 352 CG8629-RA 36..287 17..268 1260 100 Plus
CG8628-RA 429 CG8628-RA 71..310 29..268 810 89.2 Plus
CG8628-RB 408 CG8628-RB 50..289 29..268 810 89.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7127978..7128229 268..17 1260 100 Minus
3L 28110227 3L 7131147..7131386 29..268 810 89.2 Plus
Blast to na_te.dros performed on 2014-11-27 14:16:41 has no hits.

BO16003.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:20 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 32..287 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:39 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..287 17..270 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:24:57 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 32..283 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:07:31 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
CG8629-RA 36..287 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:07:31 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7127976..7128229 17..270 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:39 Download gff for BO16003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7121076..7121329 17..270 99   Minus

BO16003.pep Sequence

Translation from 16 to 286

> BO16003.pep
MVSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKK
KAMYEAWNAHKGLSKDAAKEAYVKVYEKYAPKYAASFLDH

BO16003.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8629-PA 84 CG8629-PA 1..84 1..84 435 100 Plus
CG8628-PA 84 CG8628-PA 1..84 1..84 366 83.3 Plus
CG8628-PB 84 CG8628-PB 1..84 1..84 366 83.3 Plus
CG15829-PB 82 CG15829-PB 1..81 1..83 240 56.6 Plus
CG15829-PA 82 CG15829-PA 1..81 1..83 240 56.6 Plus