Clone BO16006 Report

Search the DGRC for BO16006

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG11368-RA
Protein status:BO16006.pep: Imported from assembly
Sequenced Size:229

Clone Sequence Records

BO16006.5prime Sequence

227 bp (227 high quality bases) assembled on 2006-06-16

> BO16006.5prime
GAAGTTATCAGTCGACATGCATCTGAACCTGAAATATTTCATTGGTCTGC
TACTGGTGCTGCTTTGCAGCTCTTTTGCGGTGGCCTATCCCCAGGGGCCT
GGGTGTGGTCCACCACCAAGTGGAACACCTCCGTCGGGACCGCGACCATC
GGGTCCACCACCTGGAGGTCGCTGCGGACCACCACCATCGACCACGGCTG
CATCTACCGGTGCAAGCTTTCTAGACC

BO16006.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-PA 198 CG11368-RA 1..195 17..211 950 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 06:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-RA 361 CG11368-RA 29..223 17..211 960 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 06:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7452373..7452505 79..211 650 99.2 Plus
X 23542271 X 7452237..7452301 17..81 325 100 Plus
Blast to na_te.dros performed on 2015-01-31 06:31:07 has no hits.

BO16006.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:33 Download gff for BO16006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-PA 1..198 17..215 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 22:09:26 Download gff for BO16006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..230 17..220 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 07:41:43 Download gff for BO16006.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..230 17..220 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 07:41:43 Download gff for BO16006.5prime
Subject Subject Range Query Range Percent Splice Strand
X 7452237..7452299 17..79 100 -> Plus
X 7452374..7452512 80..220 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 22:09:26 Download gff for BO16006.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 7346270..7346332 17..79 100 -> Plus
arm_X 7346407..7346545 80..220 96   Plus

BO16006.3prime Sequence

227 bp (227 high quality bases) assembled on 2006-06-16

> BO16006.3prime
ATGGTCTAGAAAGCTTGCACCGGTAGATGCAGCCGTGGTCGATGGTGGTG
GTCCGCAGCGACCTCCAGGTGGTGGACCCGATGGTCGCGGTCCCGACGGA
GGTGTTCCACTTGGTGGTGGACCACACCCAGGCCCCTGGGGATAGGCCAC
CGCAAAAGAGCTGCAAAGCAGCACCAGTAGCAGACCAATGAAATATTTCA
GGTTCAGATGCATGTCGACTGATAACT

BO16006.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-PA 198 CG11368-RA 1..195 213..19 950 99.4 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-RA 361 CG11368-RA 29..223 213..19 960 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7452373..7452505 151..19 650 99.2 Minus
X 23542271 X 7452237..7452301 213..149 325 100 Minus
Blast to na_te.dros performed on 2015-02-08 11:52:52 has no hits.

BO16006.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:32 Download gff for BO16006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-PA 1..198 15..213 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:16:51 Download gff for BO16006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..230 10..213 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:34:37 Download gff for BO16006.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..230 10..213 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:34:37 Download gff for BO16006.3prime
Subject Subject Range Query Range Percent Splice Strand
X 7452237..7452299 151..213 100 -> Minus
X 7452374..7452512 10..150 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:16:51 Download gff for BO16006.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 7346270..7346332 151..213 100 -> Minus
arm_X 7346407..7346545 10..150 96   Minus

BO16006.complete Sequence

229 bp assembled on 2008-08-15

GenBank Submission: FJ633662

> BO16006.complete
GAAGTTATCAGTCGACATGCATCTGAACCTGAAATATTTCATTGGTCTGC
TACTGGTGCTGCTTTGCAGCTCTTTTGCGGTGGCCTATCCCCAGGGGCCT
GGGTGTGGTCCACCACCAAGTGGAACACCTCCGTCGGGACCGCGACCATC
GGGTCCACCACCTGGAGGTCGCTGCGGACCACCACCATCGACCACGGCTG
CATCTACCGGTGCAAGCTTTCTAGACCAT

BO16006.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-RA 198 CG11368-PA 1..195 17..211 960 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-RA 361 CG11368-RA 29..223 17..211 960 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7452373..7452505 79..211 650 99.2 Plus
X 23542271 X 7452237..7452301 17..81 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:09:17 has no hits.

BO16006.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:48:12 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 30..231 17..220 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:48:35 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..223 17..213 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:12:23 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 30..224 17..213 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:52:48 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
CG11368-RA 29..223 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:52:48 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
X 7452237..7452299 17..79 100 -> Plus
X 7452374..7452505 80..213 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:48:35 Download gff for BO16006.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7346270..7346332 17..79 100 -> Plus
arm_X 7346407..7346538 80..213 97   Plus

BO16006.pep Sequence

Translation from 16 to 229

> BO16006.pep
MHLNLKYFIGLLLVLLCSSFAVAYPQGPGCGPPPSGTPPSGPRPSGPPPG
GRCGPPPSTTAASTGASFLDH

BO16006.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11368-PA 65 CG11368-PA 1..65 1..65 367 100 Plus