Clone BO16007 Report

Search the DGRC for BO16007

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptIM2-RA
Protein status:BO16007.pep: Imported from assembly
Sequenced Size:169

Clone Sequence Records

BO16007.3prime Sequence

167 bp (167 high quality bases) assembled on 2006-06-16

> BO16007.3prime
ATGGTCTAGAAAGCTTGCCTTTCCACCGTGCACATTGCAGTATTTGCAGT
CCCCGTTGATTACCACATTTCCTGGATCGGGCGACAGGGGAACAGCGTTG
GCCAGAGCCAGCAGACCGAACACAAAGACGGTGACGACTGAGAAGAACTT
CATGTCGACTGATAACT

BO16007.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18106-PA 138 IM2-RA 1..135 153..19 675 100 Minus
CG18108-PA 138 IM1-RA 1..90 153..64 300 93.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-RA 367 CG18106-RA 72..206 153..19 675 100 Minus
IM1-RA 361 CG18108-RA 75..209 153..19 405 86.7 Minus
CG18107-RA 281 CG18107-RA 77..177 147..47 235 82.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18386792..18386869 96..19 390 100 Minus
2R 25286936 2R 18386673..18386730 153..96 290 100 Minus
2R 25286936 2R 18384023..18384078 153..98 220 92.9 Minus
2R 25286936 2R 18384149..18384226 96..19 195 83.3 Minus
Blast to na_te.dros performed on 2015-02-02 14:39:44 has no hits.

BO16007.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:33 Download gff for BO16007.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18106-PA 1..138 18..153 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:53:25 Download gff for BO16007.3prime
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 67..206 19..158 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:23:26 Download gff for BO16007.3prime
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 67..206 19..158 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:23:26 Download gff for BO16007.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 18386668..18386730 96..158 96 -> Minus
2R 18386793..18386869 19..95 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:53:25 Download gff for BO16007.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14274173..14274235 96..158 96 -> Minus
arm_2R 14274298..14274374 19..95 100   Minus

BO16007.5prime Sequence

167 bp (167 high quality bases) assembled on 2006-06-16

> BO16007.5prime
GAAGTTATCAGTCGACATGAAGTTCTTCTCAGTCGTCACCGTCTTTGTGT
TCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATCCAGGA
AATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGTGGAAA
GGCAAGCTTTCTAGACC

BO16007.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG18106-PA 138 IM2-RA 1..135 17..151 675 100 Plus
CG18108-PA 138 IM1-RA 1..90 17..106 300 93.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-RA 367 CG18106-RA 72..206 17..151 675 100 Plus
IM1-RA 361 CG18108-RA 75..209 17..151 405 86.7 Plus
CG18107-RA 281 CG18107-RA 77..177 23..123 235 82.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18386792..18386869 74..151 390 100 Plus
2R 25286936 2R 18386673..18386730 17..74 290 100 Plus
2R 25286936 2R 18384023..18384078 17..72 220 92.9 Plus
2R 25286936 2R 18384149..18384226 74..151 195 83.3 Plus
Blast to na_te.dros performed on 2015-02-10 21:03:19 has no hits.

BO16007.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:34 Download gff for BO16007.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18106-PA 1..138 17..152 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:24:47 Download gff for BO16007.5prime
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 67..206 12..151 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:47:51 Download gff for BO16007.5prime
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 67..206 12..151 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:47:51 Download gff for BO16007.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 18386668..18386730 12..74 96 -> Plus
2R 18386793..18386869 75..151 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:24:47 Download gff for BO16007.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14274173..14274235 12..74 96 -> Plus
arm_2R 14274298..14274374 75..151 100   Plus

BO16007.complete Sequence

169 bp assembled on 2008-08-15

GenBank Submission: FJ633663

> BO16007.complete
GAAGTTATCAGTCGACATGAAGTTCTTCTCAGTCGTCACCGTCTTTGTGT
TCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATCCAGGA
AATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGTGGAAA
GGCAAGCTTTCTAGACCAT

BO16007.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-RA 138 CG18106-PA 1..135 17..151 675 100 Plus
IM1-RA 138 CG18108-PA 1..135 17..151 405 86.7 Plus
CG18107-RA 138 CG18107-PA 7..107 23..123 235 82.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-RA 367 CG18106-RA 72..206 17..151 675 100 Plus
IM1-RA 361 CG18108-RA 75..209 17..151 405 86.7 Plus
CG18107-RA 281 CG18107-RA 77..177 23..123 235 82.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18386792..18386869 74..151 390 100 Plus
2R 25286936 2R 18386673..18386730 17..74 290 100 Plus
2R 25286936 2R 18384023..18384078 17..72 220 92.9 Plus
2R 25286936 2R 18384149..18384226 74..151 195 83.3 Plus
Blast to na_te.dros performed on 2014-11-27 16:31:32 has no hits.

BO16007.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:36:02 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 72..211 12..151 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:55:14 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 72..206 17..153 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:56:41 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 77..211 17..153 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:20:27 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 72..206 17..153 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:20:27 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18386673..18386730 17..74 100 -> Plus
2R 18386793..18386869 75..153 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:55:14 Download gff for BO16007.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14274178..14274235 17..74 100 -> Plus
arm_2R 14274298..14274374 75..153 97   Plus

BO16007.pep Sequence

Translation from 16 to 169

> BO16007.pep
MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNVHGGKASFLD
H

BO16007.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-PA 45 CG18106-PA 1..45 1..45 241 100 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 220 88.9 Plus
CG18107-PA 45 CG18107-PA 1..45 1..45 202 80 Plus
CG15068-PA 40 CG15068-PA 1..39 1..43 132 65.1 Plus
IM3-PB 39 CG16844-PB 1..37 1..41 130 68.3 Plus