Clone Sequence Records
BO16007.3prime Sequence
167 bp (167 high quality bases) assembled on 2006-06-16
> BO16007.3prime
ATGGTCTAGAAAGCTTGCCTTTCCACCGTGCACATTGCAGTATTTGCAGT
CCCCGTTGATTACCACATTTCCTGGATCGGGCGACAGGGGAACAGCGTTG
GCCAGAGCCAGCAGACCGAACACAAAGACGGTGACGACTGAGAAGAACTT
CATGTCGACTGATAACT
BO16007.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18106-PA | 138 | IM2-RA | 1..135 | 153..19 | 675 | 100 | Minus |
CG18108-PA | 138 | IM1-RA | 1..90 | 153..64 | 300 | 93.3 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:39:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM2-RA | 367 | CG18106-RA | 72..206 | 153..19 | 675 | 100 | Minus |
IM1-RA | 361 | CG18108-RA | 75..209 | 153..19 | 405 | 86.7 | Minus |
CG18107-RA | 281 | CG18107-RA | 77..177 | 147..47 | 235 | 82.2 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:39:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18386792..18386869 | 96..19 | 390 | 100 | Minus |
2R | 25286936 | 2R | 18386673..18386730 | 153..96 | 290 | 100 | Minus |
2R | 25286936 | 2R | 18384023..18384078 | 153..98 | 220 | 92.9 | Minus |
2R | 25286936 | 2R | 18384149..18384226 | 96..19 | 195 | 83.3 | Minus |
Blast to na_te.dros performed on 2015-02-02 14:39:44 has no hits.
BO16007.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:33 Download gff for
BO16007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18106-PA | 1..138 | 18..153 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:53:25 Download gff for
BO16007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 67..206 | 19..158 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:23:26 Download gff for
BO16007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 67..206 | 19..158 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:23:26 Download gff for
BO16007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18386668..18386730 | 96..158 | 96 | -> | Minus |
2R | 18386793..18386869 | 19..95 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:53:25 Download gff for
BO16007.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14274173..14274235 | 96..158 | 96 | -> | Minus |
arm_2R | 14274298..14274374 | 19..95 | 100 | | Minus |
BO16007.5prime Sequence
167 bp (167 high quality bases) assembled on 2006-06-16
> BO16007.5prime
GAAGTTATCAGTCGACATGAAGTTCTTCTCAGTCGTCACCGTCTTTGTGT
TCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATCCAGGA
AATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGTGGAAA
GGCAAGCTTTCTAGACC
BO16007.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18106-PA | 138 | IM2-RA | 1..135 | 17..151 | 675 | 100 | Plus |
CG18108-PA | 138 | IM1-RA | 1..90 | 17..106 | 300 | 93.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:03:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM2-RA | 367 | CG18106-RA | 72..206 | 17..151 | 675 | 100 | Plus |
IM1-RA | 361 | CG18108-RA | 75..209 | 17..151 | 405 | 86.7 | Plus |
CG18107-RA | 281 | CG18107-RA | 77..177 | 23..123 | 235 | 82.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:03:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18386792..18386869 | 74..151 | 390 | 100 | Plus |
2R | 25286936 | 2R | 18386673..18386730 | 17..74 | 290 | 100 | Plus |
2R | 25286936 | 2R | 18384023..18384078 | 17..72 | 220 | 92.9 | Plus |
2R | 25286936 | 2R | 18384149..18384226 | 74..151 | 195 | 83.3 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:03:19 has no hits.
BO16007.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:34 Download gff for
BO16007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18106-PA | 1..138 | 17..152 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:24:47 Download gff for
BO16007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 67..206 | 12..151 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:47:51 Download gff for
BO16007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 67..206 | 12..151 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:47:51 Download gff for
BO16007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18386668..18386730 | 12..74 | 96 | -> | Plus |
2R | 18386793..18386869 | 75..151 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:24:47 Download gff for
BO16007.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14274173..14274235 | 12..74 | 96 | -> | Plus |
arm_2R | 14274298..14274374 | 75..151 | 100 | | Plus |
BO16007.complete Sequence
169 bp assembled on 2008-08-15
GenBank Submission: FJ633663
> BO16007.complete
GAAGTTATCAGTCGACATGAAGTTCTTCTCAGTCGTCACCGTCTTTGTGT
TCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATCCAGGA
AATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGTGGAAA
GGCAAGCTTTCTAGACCAT
BO16007.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM2-RA | 138 | CG18106-PA | 1..135 | 17..151 | 675 | 100 | Plus |
IM1-RA | 138 | CG18108-PA | 1..135 | 17..151 | 405 | 86.7 | Plus |
CG18107-RA | 138 | CG18107-PA | 7..107 | 23..123 | 235 | 82.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM2-RA | 367 | CG18106-RA | 72..206 | 17..151 | 675 | 100 | Plus |
IM1-RA | 361 | CG18108-RA | 75..209 | 17..151 | 405 | 86.7 | Plus |
CG18107-RA | 281 | CG18107-RA | 77..177 | 23..123 | 235 | 82.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18386792..18386869 | 74..151 | 390 | 100 | Plus |
2R | 25286936 | 2R | 18386673..18386730 | 17..74 | 290 | 100 | Plus |
2R | 25286936 | 2R | 18384023..18384078 | 17..72 | 220 | 92.9 | Plus |
2R | 25286936 | 2R | 18384149..18384226 | 74..151 | 195 | 83.3 | Plus |
Blast to na_te.dros performed on 2014-11-27 16:31:32 has no hits.
BO16007.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:36:02 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 72..211 | 12..151 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:55:14 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 72..206 | 17..153 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:56:41 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 77..211 | 17..153 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:20:27 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
IM2-RA | 72..206 | 17..153 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:20:27 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18386673..18386730 | 17..74 | 100 | -> | Plus |
2R | 18386793..18386869 | 75..153 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:55:14 Download gff for
BO16007.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14274178..14274235 | 17..74 | 100 | -> | Plus |
arm_2R | 14274298..14274374 | 75..153 | 97 | | Plus |
BO16007.pep Sequence
Translation from 16 to 169
> BO16007.pep
MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNVHGGKASFLD
H
BO16007.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 241 | 100 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 220 | 88.9 | Plus |
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 202 | 80 | Plus |
CG15068-PA | 40 | CG15068-PA | 1..39 | 1..43 | 132 | 65.1 | Plus |
IM3-PB | 39 | CG16844-PB | 1..37 | 1..41 | 130 | 68.3 | Plus |