Clone BO16009 Report

Search the DGRC for BO16009

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG13751-RA
Protein status:BO16009.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO16009.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16009.5prime
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAAGCA
AGCTTTCTAGACC

BO16009.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 234 CG13751-RA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 102..332 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900342..8900572 17..247 1155 100 Plus
Blast to na_te.dros performed on 2015-02-10 18:27:00 has no hits.

BO16009.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:35 Download gff for BO16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-PA 1..234 17..251 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:48:26 Download gff for BO16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..341 17..256 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:55:09 Download gff for BO16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..341 17..256 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:55:09 Download gff for BO16009.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8900342..8900581 17..256 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:48:26 Download gff for BO16009.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787847..4788086 17..256 98   Plus

BO16009.complete Sequence

265 bp assembled on 2008-08-15

GenBank Submission: FJ633664

> BO16009.complete
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAAGCA
AGCTTTCTAGACCAT

BO16009.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 234 CG13751-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 102..332 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900342..8900572 17..247 1155 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:39:00 has no hits.

BO16009.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:43:47 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..341 17..256 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:34:30 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..332 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:06:53 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..332 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:24 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..332 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:24 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900342..8900572 17..249 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:34:30 Download gff for BO16009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787847..4788077 17..249 99   Plus

BO16009.pep Sequence

Translation from 16 to 265

> BO16009.pep
MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL
LENMQATEVLAQENGNGSNEEDNDFEEASFLDH

BO16009.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 77 CG13751-PA 1..77 1..77 396 100 Plus