Clone BO16013 Report

Search the DGRC for BO16013

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG4440-RA
Protein status:BO16013.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16013.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16013.5prime
GAAGTTATCAGTCGACATGAAATTCTTGATTTTCTGTCTGATTGCTCTGT
TTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTCGGCGGATTTGGTGGC
GGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGGACAAGGATTCGGTGG
TTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAAGTTTTGGCGGAAATG
GAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGTTTCGGCGGTTTTTAC
GGTGCAAGCTTTCTAGACC

BO16013.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PA 240 CG4440-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 04:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 538 CG4440-RB 84..320 17..253 1185 100 Plus
CG4440-RA 384 CG4440-RA 84..320 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 04:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330303 28..253 1130 100 Plus
Blast to na_te.dros performed on 2015-02-03 04:44:04 has no hits.

BO16013.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:37 Download gff for BO16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-PA 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:11:14 Download gff for BO16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 79..323 12..257 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:24:35 Download gff for BO16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 79..323 12..257 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:24:35 Download gff for BO16013.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16330074..16330306 23..257 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:11:14 Download gff for BO16013.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16330074..16330306 23..257 98   Plus

BO16013.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633665

> BO16013.complete
GAAGTTATCAGTCGACATGAAATTCTTGATTTTCTGTCTGATTGCTCTGT
TTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTCGGCGGATTTGGTGGC
GGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGGACAAGGATTCGGTGG
TTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAAGTTTTGGCGGAAATG
GAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGTTTCGGCGGTTTTTAC
GGTGCAAGCTTTCTAGACCAT

BO16013.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 240 CG4440-PB 1..237 17..253 1185 100 Plus
CG4440-RA 240 CG4440-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 538 CG4440-RB 84..320 17..253 1185 100 Plus
CG4440-RA 384 CG4440-RA 84..320 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330303 28..253 1130 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:19:21 has no hits.

BO16013.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:17 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 77..321 12..257 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:45:43 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 84..320 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:23:54 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 82..318 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:03 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 84..320 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:03 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16330074..16330303 23..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:45:43 Download gff for BO16013.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16330074..16330303 23..255 98   Plus

BO16013.pep Sequence

Translation from 16 to 271

> BO16013.pep
MKFLIFCLIALFAIASARPQFGFGGFGGGLEQQQQQGGFGQGFGGFGSFG
QQQQQESFGGNGNFGQQQQEFGGFGGFYGASFLDH

BO16013.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PB 79 CG4440-PB 1..79 1..79 429 100 Plus
CG4440-PA 79 CG4440-PA 1..79 1..79 429 100 Plus
CG15282-PB 79 CG15282-PB 1..78 1..74 228 66.7 Plus
CG15282-PC 79 CG15282-PC 1..78 1..74 228 66.7 Plus
CG15282-PA 79 CG15282-PA 1..78 1..74 228 66.7 Plus