Clone Sequence Records
BO16014.3prime Sequence
269 bp (269 high quality bases) assembled on 2006-06-16
> BO16014.3prime
ATGGTCTAGAAAGCTTGCGACACGCCTTCTGCAACGCCCATGATGATCGC
GAACGAATCCGCGTGGGCAGCGATTTCCGCGCACATCAAGGAGCATTCCC
TTGCCCAGGGCATCGCTGTTGTTTTTGGCCGCCTCTAGGGCTTGGGTGGT
GTTCAGTTGATTGAAGTAGATCACCCTGCCGGATTCAGTGCACGAGGAGC
CGAGCAGCAGAGCCAGGAGCAGCAGAAATCCCACCGACGGCAGTACAGAT
CGCATGTCGACTGATAACT
BO16014.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-PA | 240 | CG32695-RA | 1..237 | 255..19 | 1185 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:47:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-RC | 1613 | CG32695-RC | 90..330 | 259..19 | 1190 | 99.6 | Minus |
CG32695-RB | 512 | CG32695-RB | 22..262 | 259..19 | 1190 | 99.6 | Minus |
CG32695-RA | 385 | CG32695-RA | 22..262 | 259..19 | 1190 | 99.6 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:47:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9873734..9873968 | 25..259 | 1160 | 99.6 | Plus |
Blast to na_te.dros performed on 2015-02-12 12:47:31 has no hits.
BO16014.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:38 Download gff for
BO16014.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-PA | 1..240 | 15..255 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:33:23 Download gff for
BO16014.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 22..269 | 12..259 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:27:11 Download gff for
BO16014.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 22..269 | 12..259 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:27:11 Download gff for
BO16014.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9873731..9873968 | 21..259 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:33:23 Download gff for
BO16014.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9767764..9768001 | 21..259 | 99 | | Plus |
BO16014.5prime Sequence
269 bp (269 high quality bases) assembled on 2006-06-16
> BO16014.5prime
GAAGTTATCAGTCGACATGCGATCTGTACTGCCGTCGGTGGGATTTCTGC
TGCTCCTGGCTCTGCTGCTCGGCTCCTCGTGCACTGAATCCGGCAGGGTG
ATCTACTTCAATCAACTGAACACCACCCAAGCCCTAGAGGCGGCCAAAAA
CAACAGCGATGCCCTGGGCAAGGGAATGCTCCTTGATGTGCGCGGAAATC
GCTGCCCACGCGGATTCGTTCGCGATCATCATGGGCGTTGCAGAAGGCGT
GTCGCAAGCTTTCTAGACC
BO16014.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-PA | 240 | CG32695-RA | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:49:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-RC | 1613 | CG32695-RC | 90..330 | 13..253 | 1190 | 99.6 | Plus |
CG32695-RB | 512 | CG32695-RB | 22..262 | 13..253 | 1190 | 99.6 | Plus |
CG32695-RA | 385 | CG32695-RA | 22..262 | 13..253 | 1190 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:49:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9873734..9873968 | 247..13 | 1160 | 99.6 | Minus |
Blast to na_te.dros performed on 2015-01-30 17:49:18 has no hits.
BO16014.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:39 Download gff for
BO16014.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-PA | 1..240 | 17..257 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:12:45 Download gff for
BO16014.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 22..269 | 13..260 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:33:30 Download gff for
BO16014.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 22..269 | 13..260 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:33:30 Download gff for
BO16014.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9873731..9873968 | 13..251 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:12:45 Download gff for
BO16014.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9767764..9768001 | 13..251 | 99 | | Minus |
BO16014.complete Sequence
271 bp assembled on 2008-08-15
GenBank Submission: FJ633666
> BO16014.complete
GAAGTTATCAGTCGACATGCGATCTGTACTGCCGTCGGTGGGATTTCTGC
TGCTCCTGGCTCTGCTGCTCGGCTCCTCGTGCACTGAATCCGGCAGGGTG
ATCTACTTCAATCAACTGAACACCACCCAAGCCCTAGAGGCGGCCAAAAA
CAACAGCGATGCCCTGGGCAAGGGAATGCTCCTTGATGTGCGCGGAAATC
GCTGCCCACGCGGATTCGTTCGCGATCATCATGGGCGTTGCAGAAGGCGT
GTCGCAAGCTTTCTAGACCAT
BO16014.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:02:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-RC | 240 | CG32695-PC | 1..237 | 17..253 | 1185 | 100 | Plus |
CG32695-RB | 240 | CG32695-PB | 1..237 | 17..253 | 1185 | 100 | Plus |
CG32695-RA | 240 | CG32695-PA | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:02:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-RC | 1613 | CG32695-RC | 90..330 | 13..253 | 1190 | 99.6 | Plus |
CG32695-RB | 512 | CG32695-RB | 22..262 | 13..253 | 1190 | 99.6 | Plus |
CG32695-RA | 385 | CG32695-RA | 22..262 | 13..253 | 1190 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:02:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9873734..9873968 | 247..13 | 1160 | 99.6 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:02:01 has no hits.
BO16014.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:04 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 22..269 | 13..260 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:36:19 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 26..262 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:54:12 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 26..262 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:21 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32695-RA | 26..262 | 17..255 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:21 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9873726..9873964 | 17..255 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:36:19 Download gff for
BO16014.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9767759..9767997 | 17..255 | 98 | | Minus |
BO16014.pep Sequence
Translation from 16 to 271
> BO16014.pep
MRSVLPSVGFLLLLALLLGSSCTESGRVIYFNQLNTTQALEAAKNNSDAL
GKGMLLDVRGNRCPRGFVRDHHGRCRRRVASFLDH
BO16014.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32695-PC | 79 | CG32695-PC | 1..79 | 1..79 | 407 | 100 | Plus |
CG32695-PB | 79 | CG32695-PB | 1..79 | 1..79 | 407 | 100 | Plus |
CG32695-PA | 79 | CG32695-PA | 1..79 | 1..79 | 407 | 100 | Plus |