Clone BO16014 Report

Search the DGRC for BO16014

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG32695-RA
Protein status:BO16014.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16014.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16014.3prime
ATGGTCTAGAAAGCTTGCGACACGCCTTCTGCAACGCCCATGATGATCGC
GAACGAATCCGCGTGGGCAGCGATTTCCGCGCACATCAAGGAGCATTCCC
TTGCCCAGGGCATCGCTGTTGTTTTTGGCCGCCTCTAGGGCTTGGGTGGT
GTTCAGTTGATTGAAGTAGATCACCCTGCCGGATTCAGTGCACGAGGAGC
CGAGCAGCAGAGCCAGGAGCAGCAGAAATCCCACCGACGGCAGTACAGAT
CGCATGTCGACTGATAACT

BO16014.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-PA 240 CG32695-RA 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-RC 1613 CG32695-RC 90..330 259..19 1190 99.6 Minus
CG32695-RB 512 CG32695-RB 22..262 259..19 1190 99.6 Minus
CG32695-RA 385 CG32695-RA 22..262 259..19 1190 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9873734..9873968 25..259 1160 99.6 Plus
Blast to na_te.dros performed on 2015-02-12 12:47:31 has no hits.

BO16014.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:38 Download gff for BO16014.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-PA 1..240 15..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:33:23 Download gff for BO16014.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 22..269 12..259 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:27:11 Download gff for BO16014.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 22..269 12..259 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:27:11 Download gff for BO16014.3prime
Subject Subject Range Query Range Percent Splice Strand
X 9873731..9873968 21..259 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:33:23 Download gff for BO16014.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9767764..9768001 21..259 99   Plus

BO16014.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16014.5prime
GAAGTTATCAGTCGACATGCGATCTGTACTGCCGTCGGTGGGATTTCTGC
TGCTCCTGGCTCTGCTGCTCGGCTCCTCGTGCACTGAATCCGGCAGGGTG
ATCTACTTCAATCAACTGAACACCACCCAAGCCCTAGAGGCGGCCAAAAA
CAACAGCGATGCCCTGGGCAAGGGAATGCTCCTTGATGTGCGCGGAAATC
GCTGCCCACGCGGATTCGTTCGCGATCATCATGGGCGTTGCAGAAGGCGT
GTCGCAAGCTTTCTAGACC

BO16014.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-PA 240 CG32695-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-RC 1613 CG32695-RC 90..330 13..253 1190 99.6 Plus
CG32695-RB 512 CG32695-RB 22..262 13..253 1190 99.6 Plus
CG32695-RA 385 CG32695-RA 22..262 13..253 1190 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9873734..9873968 247..13 1160 99.6 Minus
Blast to na_te.dros performed on 2015-01-30 17:49:18 has no hits.

BO16014.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:39 Download gff for BO16014.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-PA 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:12:45 Download gff for BO16014.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 22..269 13..260 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:33:30 Download gff for BO16014.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 22..269 13..260 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:33:30 Download gff for BO16014.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9873731..9873968 13..251 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:12:45 Download gff for BO16014.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9767764..9768001 13..251 99   Minus

BO16014.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633666

> BO16014.complete
GAAGTTATCAGTCGACATGCGATCTGTACTGCCGTCGGTGGGATTTCTGC
TGCTCCTGGCTCTGCTGCTCGGCTCCTCGTGCACTGAATCCGGCAGGGTG
ATCTACTTCAATCAACTGAACACCACCCAAGCCCTAGAGGCGGCCAAAAA
CAACAGCGATGCCCTGGGCAAGGGAATGCTCCTTGATGTGCGCGGAAATC
GCTGCCCACGCGGATTCGTTCGCGATCATCATGGGCGTTGCAGAAGGCGT
GTCGCAAGCTTTCTAGACCAT

BO16014.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-RC 240 CG32695-PC 1..237 17..253 1185 100 Plus
CG32695-RB 240 CG32695-PB 1..237 17..253 1185 100 Plus
CG32695-RA 240 CG32695-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-RC 1613 CG32695-RC 90..330 13..253 1190 99.6 Plus
CG32695-RB 512 CG32695-RB 22..262 13..253 1190 99.6 Plus
CG32695-RA 385 CG32695-RA 22..262 13..253 1190 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9873734..9873968 247..13 1160 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 15:02:01 has no hits.

BO16014.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:04 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 22..269 13..260 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:36:19 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 26..262 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:54:12 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 26..262 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:21 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
CG32695-RA 26..262 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:21 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
X 9873726..9873964 17..255 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:36:19 Download gff for BO16014.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9767759..9767997 17..255 98   Minus

BO16014.pep Sequence

Translation from 16 to 271

> BO16014.pep
MRSVLPSVGFLLLLALLLGSSCTESGRVIYFNQLNTTQALEAAKNNSDAL
GKGMLLDVRGNRCPRGFVRDHHGRCRRRVASFLDH

BO16014.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32695-PC 79 CG32695-PC 1..79 1..79 407 100 Plus
CG32695-PB 79 CG32695-PB 1..79 1..79 407 100 Plus
CG32695-PA 79 CG32695-PA 1..79 1..79 407 100 Plus