Clone BO16016 Report

Search the DGRC for BO16016

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptCG13159-RA
Protein status:BO16016.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO16016.3prime Sequence

260 bp (260 high quality bases) assembled on 2006-06-16

> BO16016.3prime
ATGGTCTAGAAAGCTTGCTCCGGACTTCTTGTTGAACAGCAGGGACAGGA
GCTGTTGCTTGATTGGCTTAGTGGTGGTGGTGTCCGTGGTGTAGGTGTAG
GTGGGGTAGGTCGGGGTGGTAGTATAGGTGTACGTCGTCGTCGTGGGCGA
AGAGGGCGTTGTGGGAGTGCTGGTTGTAGTTGCGGTAGATGCCATTGCGA
TGGCCAGGACAGCGGAGAAACAGACGAGGACAGCGAAGAACTTCATGTCG
ACTGATAACT

BO16016.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-PA 231 CG13159-RA 1..228 246..19 1140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 06:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-RA 393 CG13159-RA 82..311 248..19 1150 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 06:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12375367..12375596 248..19 1150 100 Minus
Blast to na_te.dros performed on 2015-01-31 06:32:26 has no hits.

BO16016.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:42 Download gff for BO16016.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-PA 1..231 18..246 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 22:09:50 Download gff for BO16016.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 76..317 13..254 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 07:42:00 Download gff for BO16016.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 76..317 13..254 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 07:42:00 Download gff for BO16016.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12375361..12375602 13..254 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 22:09:50 Download gff for BO16016.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262866..8263107 13..254 97   Minus

BO16016.5prime Sequence

260 bp (260 high quality bases) assembled on 2006-06-16

> BO16016.5prime
GAAGTTATCAGTCGACATGAAGTTCTTCGCTGTCCTCGTCTGTTTCTCCG
CTGTCCTGGCCATCGCAATGGCATCTACCGCAACTACAACCAGCACTCCC
ACAACGCCCTCTTCGCCCACGACGACGACGTACACCTATACTACCACCCC
GACCTACCCCACCTACACCTACACCACGGACACCACCACCACTAAGCCAA
TCAAGCAACAGCTCCTGTCCCTGCTGTTCAACAAGAAGTCCGGAGCAAGC
TTTCTAGACC

BO16016.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-PA 231 CG13159-RA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-RA 393 CG13159-RA 82..311 15..244 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12375367..12375596 15..244 1150 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:05:43 has no hits.

BO16016.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:43 Download gff for BO16016.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-PA 1..231 17..245 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:25:18 Download gff for BO16016.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 76..317 9..250 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:32:08 Download gff for BO16016.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 76..317 9..250 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:32:08 Download gff for BO16016.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12375361..12375602 9..250 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:25:18 Download gff for BO16016.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262866..8263107 9..250 97   Plus

BO16016.complete Sequence

262 bp assembled on 2008-08-15

GenBank Submission: FJ633667

> BO16016.complete
GAAGTTATCAGTCGACATGAAGTTCTTCGCTGTCCTCGTCTGTTTCTCCG
CTGTCCTGGCCATCGCAATGGCATCTACCGCAACTACAACCAGCACTCCC
ACAACGCCCTCTTCGCCCACGACGACGACGTACACCTATACTACCACCCC
GACCTACCCCACCTACACCTACACCACGGACACCACCACCACTAAGCCAA
TCAAGCAACAGCTCCTGTCCCTGCTGTTCAACAAGAAGTCCGGAGCAAGC
TTTCTAGACCAT

BO16016.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-RA 231 CG13159-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-RA 393 CG13159-RA 82..311 15..244 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12375367..12375596 15..244 1150 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:55:59 has no hits.

BO16016.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:23 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 73..314 9..250 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:59 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 84..311 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:06:04 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 81..308 17..246 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:59:23 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 84..311 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:59:23 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12375369..12375596 17..246 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:59 Download gff for BO16016.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262874..8263101 17..246 99   Plus

BO16016.pep Sequence

Translation from 16 to 262

> BO16016.pep
MKFFAVLVCFSAVLAIAMASTATTTSTPTTPSSPTTTTYTYTTTPTYPTY
TYTTDTTTTKPIKQQLLSLLFNKKSGASFLDH

BO16016.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-PA 76 CG13159-PA 1..76 1..76 389 100 Plus