Clone BO16019 Report

Search the DGRC for BO16019

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptNeb-cGP-RA
Protein status:BO16019.pep: Imported from assembly
Sequenced Size:178

Clone Sequence Records

BO16019.3prime Sequence

176 bp (176 high quality bases) assembled on 2006-06-16

> BO16019.3prime
ATGGTCTAGAAAGCTTGCCTTCTTCTTGGGCTTCAGCACCTGGTAGGCGA
TCAGCAGGCCCATCACGGCGTACGTGGCCTTGGCCACATTTGCACGGCCG
CTCATGGTGGTGCCATTGAAGATTTTCGACAGGCCGGTCAGTTTCTCGCC
TTCGCCAGCCATGTCGACTGATAACT

BO16019.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15304-PA 147 Neb-cGP-RA 1..144 162..19 720 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..259 162..19 720 100 Minus
Neb-cGP-RA 410 CG15304-RA 116..259 162..19 720 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 162..85 390 100 Minus
X 23542271 X 10461082..10461150 87..19 345 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:01:01 has no hits.

BO16019.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:43 Download gff for BO16019.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15304-PA 1..147 18..162 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:16:44 Download gff for BO16019.3prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 19..162 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:22:17 Download gff for BO16019.3prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 19..162 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:22:17 Download gff for BO16019.3prime
Subject Subject Range Query Range Percent Splice Strand
X 10460914..10460996 88..171 95 -> Minus
X 10461082..10461150 19..87 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:16:44 Download gff for BO16019.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354947..10355029 88..171 95 -> Minus
arm_X 10355115..10355183 19..87 100   Minus

BO16019.5prime Sequence

176 bp (176 high quality bases) assembled on 2006-06-16

> BO16019.5prime
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGGCAAGCTTTCTAGACC

BO16019.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15304-PA 147 Neb-cGP-RA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..259 17..160 720 100 Plus
Neb-cGP-RA 410 CG15304-RA 116..259 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 17..94 390 100 Plus
X 23542271 X 10461082..10461150 92..160 345 100 Plus
Blast to na_te.dros performed on 2015-02-12 04:26:31 has no hits.

BO16019.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:45 Download gff for BO16019.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15304-PA 1..147 17..161 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:21 Download gff for BO16019.5prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 17..160 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:03:58 Download gff for BO16019.5prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 17..160 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:03:58 Download gff for BO16019.5prime
Subject Subject Range Query Range Percent Splice Strand
X 10460914..10460996 8..91 95 -> Plus
X 10461082..10461150 92..160 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:21 Download gff for BO16019.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354947..10355029 8..91 95 -> Plus
arm_X 10355115..10355183 92..160 100   Plus

BO16019.complete Sequence

178 bp assembled on 2008-08-15

GenBank Submission: FJ633668

> BO16019.complete
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGGCAAGCTTTCTAGACCAT

BO16019.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 147 CG15304-PB 1..144 17..160 720 100 Plus
Neb-cGP-RA 147 CG15304-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..259 17..160 720 100 Plus
Neb-cGP-RA 410 CG15304-RA 116..259 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 17..94 390 100 Plus
X 23542271 X 10461082..10461150 92..160 345 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:35:48 has no hits.

BO16019.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:59 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 108..251 17..160 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:05 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 17..162 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:55:29 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 108..251 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:51 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..259 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:51 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
X 10460922..10460996 17..91 100 -> Plus
X 10461082..10461150 92..162 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:05 Download gff for BO16019.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354955..10355029 17..91 100 -> Plus
arm_X 10355115..10355183 92..162 97   Plus

BO16019.pep Sequence

Translation from 16 to 178

> BO16019.pep
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKKAS
FLDH

BO16019.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-PB 48 CG15304-PB 1..48 1..48 237 100 Plus
Neb-cGP-PA 48 CG15304-PA 1..48 1..48 237 100 Plus