Clone Sequence Records
BO16019.3prime Sequence
176 bp (176 high quality bases) assembled on 2006-06-16
> BO16019.3prime
ATGGTCTAGAAAGCTTGCCTTCTTCTTGGGCTTCAGCACCTGGTAGGCGA
TCAGCAGGCCCATCACGGCGTACGTGGCCTTGGCCACATTTGCACGGCCG
CTCATGGTGGTGCCATTGAAGATTTTCGACAGGCCGGTCAGTTTCTCGCC
TTCGCCAGCCATGTCGACTGATAACT
BO16019.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15304-PA | 147 | Neb-cGP-RA | 1..144 | 162..19 | 720 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:01:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..259 | 162..19 | 720 | 100 | Minus |
Neb-cGP-RA | 410 | CG15304-RA | 116..259 | 162..19 | 720 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:00:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 162..85 | 390 | 100 | Minus |
X | 23542271 | X | 10461082..10461150 | 87..19 | 345 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 16:01:01 has no hits.
BO16019.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:43 Download gff for
BO16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15304-PA | 1..147 | 18..162 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:16:44 Download gff for
BO16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 19..162 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:22:17 Download gff for
BO16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 19..162 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:22:17 Download gff for
BO16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460914..10460996 | 88..171 | 95 | -> | Minus |
X | 10461082..10461150 | 19..87 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:16:44 Download gff for
BO16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354947..10355029 | 88..171 | 95 | -> | Minus |
arm_X | 10355115..10355183 | 19..87 | 100 | | Minus |
BO16019.5prime Sequence
176 bp (176 high quality bases) assembled on 2006-06-16
> BO16019.5prime
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGGCAAGCTTTCTAGACC
BO16019.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15304-PA | 147 | Neb-cGP-RA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:26:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..259 | 17..160 | 720 | 100 | Plus |
Neb-cGP-RA | 410 | CG15304-RA | 116..259 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:26:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 17..94 | 390 | 100 | Plus |
X | 23542271 | X | 10461082..10461150 | 92..160 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 04:26:31 has no hits.
BO16019.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:45 Download gff for
BO16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15304-PA | 1..147 | 17..161 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:21 Download gff for
BO16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 17..160 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:03:58 Download gff for
BO16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 17..160 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:03:58 Download gff for
BO16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460914..10460996 | 8..91 | 95 | -> | Plus |
X | 10461082..10461150 | 92..160 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:21 Download gff for
BO16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354947..10355029 | 8..91 | 95 | -> | Plus |
arm_X | 10355115..10355183 | 92..160 | 100 | | Plus |
BO16019.complete Sequence
178 bp assembled on 2008-08-15
GenBank Submission: FJ633668
> BO16019.complete
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGGCAAGCTTTCTAGACCAT
BO16019.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:35:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 147 | CG15304-PB | 1..144 | 17..160 | 720 | 100 | Plus |
Neb-cGP-RA | 147 | CG15304-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:35:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..259 | 17..160 | 720 | 100 | Plus |
Neb-cGP-RA | 410 | CG15304-RA | 116..259 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:35:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 17..94 | 390 | 100 | Plus |
X | 23542271 | X | 10461082..10461150 | 92..160 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 08:35:48 has no hits.
BO16019.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:59 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 108..251 | 17..160 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:05 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:55:29 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 108..251 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:51 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..259 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:51 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460922..10460996 | 17..91 | 100 | -> | Plus |
X | 10461082..10461150 | 92..162 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:05 Download gff for
BO16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354955..10355029 | 17..91 | 100 | -> | Plus |
arm_X | 10355115..10355183 | 92..162 | 97 | | Plus |
BO16019.pep Sequence
Translation from 16 to 178
> BO16019.pep
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKKAS
FLDH
BO16019.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:21:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-PB | 48 | CG15304-PB | 1..48 | 1..48 | 237 | 100 | Plus |
Neb-cGP-PA | 48 | CG15304-PA | 1..48 | 1..48 | 237 | 100 | Plus |