Clone BO16020 Report

Search the DGRC for BO16020

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptmRpS21-RA
Protein status:BO16020.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO16020.3prime Sequence

293 bp (293 high quality bases) assembled on 2006-06-16

> BO16020.3prime
ATGGTCTAGAAAGCTTGCACTGCATCCAGGAAAAGGTTCGGCGCGATTTT
TGCGCAGTACGAACTGAATTTTTCGGTTCATGTCCTCGTTGTAAATGGCC
TTGCATTTCTCGAAGTTGATGCGACGACGAACCTGATACGGCTTTTCGTA
GAATCGCGTGCGGCGAAATTGGTCGAGCAGTTCTTCTTTTCCCAAGACGC
GATTTAACAGACGACACGCCTCCTCCACATTATTGTTTTGCACCAGAACG
GTGCGGGCCAGAAACTGCACGTGTCTCATGTCGACTGATAACT

BO16020.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32854-PA 264 mRpS21-RA 1..261 279..19 1305 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..361 283..19 1310 99.6 Minus
mRpS21-RA 422 CG32854-RA 97..361 283..19 1310 99.6 Minus
CG8870-RA 1535 CG8870-RA 1416..1531 19..134 580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 128..283 765 99.4 Plus
3R 32079331 3R 13381390..13381505 19..134 580 100 Plus
Blast to na_te.dros performed on 2015-02-11 08:14:02 has no hits.

BO16020.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:45 Download gff for BO16020.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32854-PA 1..264 15..279 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:01 Download gff for BO16020.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 90..367 12..293 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:39:27 Download gff for BO16020.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 90..367 12..293 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:39:27 Download gff for BO16020.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13381384..13381503 12..132 97 <- Plus
3R 13381563..13381720 133..293 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:01 Download gff for BO16020.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207106..9207225 12..132 97 <- Plus
arm_3R 9207285..9207442 133..293 96   Plus

BO16020.5prime Sequence

293 bp (293 high quality bases) assembled on 2006-06-16

> BO16020.5prime
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTGCAAGCTTTCTAGACC

BO16020.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32854-PA 264 mRpS21-RA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..361 13..277 1310 99.6 Plus
mRpS21-RA 422 CG32854-RA 97..361 13..277 1310 99.6 Plus
CG8870-RA 1535 CG8870-RA 1416..1531 277..162 580 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 168..13 765 99.4 Minus
3R 32079331 3R 13381390..13381505 277..162 580 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:06:19 has no hits.

BO16020.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:46 Download gff for BO16020.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32854-PA 1..264 17..281 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:25:25 Download gff for BO16020.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 92..367 5..284 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:33:11 Download gff for BO16020.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 92..367 5..284 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:33:11 Download gff for BO16020.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13381384..13381503 164..284 97 <- Minus
3R 13381563..13381718 5..163 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:25:25 Download gff for BO16020.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207106..9207225 164..284 97 <- Minus
arm_3R 9207285..9207440 5..163 97   Minus

BO16020.complete Sequence

295 bp assembled on 2008-08-15

GenBank Submission: FJ633669

> BO16020.complete
GAAGTTATCAGTCGACATGAGACACGTGCAGTTTCTGGCCCGCACCGTTC
TGGTGCAAAACAATAATGTGGAGGAGGCGTGTCGTCTGTTAAATCGCGTC
TTGGGAAAAGAAGAACTGCTCGACCAATTTCGCCGCACGCGATTCTACGA
AAAGCCGTATCAGGTTCGTCGTCGCATCAACTTCGAGAAATGCAAGGCCA
TTTACAACGAGGACATGAACCGAAAAATTCAGTTCGTACTGCGCAAAAAT
CGCGCCGAACCTTTTCCTGGATGCAGTGCAAGCTTTCTAGACCAT

BO16020.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 264 CG32854-PB 1..261 17..277 1305 100 Plus
mRpS21-RA 264 CG32854-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RB 475 CG32854-RB 97..361 13..277 1310 99.6 Plus
mRpS21-RA 422 CG32854-RA 97..361 13..277 1310 99.6 Plus
CG8870-RA 1535 CG8870-RA 1416..1531 277..162 580 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381713 168..13 765 99.4 Minus
3R 32079331 3R 13381390..13381505 277..162 580 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:45:39 has no hits.

BO16020.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:26 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 75..350 5..284 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:10 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 101..361 17..279 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:06:48 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 84..344 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:53:35 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 101..361 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:53:35 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13381388..13381503 164..279 98 <- Minus
3R 13381563..13381709 17..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:10 Download gff for BO16020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207110..9207225 164..279 98 <- Minus
arm_3R 9207285..9207431 17..163 100   Minus

BO16020.pep Sequence

Translation from 16 to 295

> BO16020.pep
MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV
RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCSASFLDH

BO16020.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-PB 87 CG32854-PB 1..87 1..87 457 100 Plus
mRpS21-PA 87 CG32854-PA 1..87 1..87 457 100 Plus