Clone Sequence Records
BO16022.3prime Sequence
290 bp (290 high quality bases) assembled on 2006-06-16
> BO16022.3prime
ATGGTCTAGAAAGCTTGCGGCATACTTGGCCACCAGGCCCTCCACAAAGG
TGATGTACTCCTGCTGGGCGGCCTCGCTGCTCTTGCCCTTCTGCTTGTTC
CAGGCCTCCCACTTGGCCTTGCCCTTCAGGTCCAGGAGACCCGGCTTGGC
GGTGTCGTTGTCACCAACGCTGGCCTGCTTGAACAGGGCGTACAGCTGCA
GGAACTCGTCATCACTGGGACGCTTGGTCAGGCTCTTCACCTTCTCGGCG
GCGGCGTTGAATTGCTCGGAAACCATGTCGACTGATAACT
BO16022.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8627-PB | 261 | Dbi-RB | 1..258 | 276..19 | 1290 | 100 | Minus |
CG8627-PA | 261 | Dbi-RA | 1..258 | 276..19 | 1290 | 100 | Minus |
CG8498-PA | 273 | CG8498-RA | 154..185 | 126..95 | 135 | 96.8 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:38:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbi-RA | 420 | CG8627-RA | 64..321 | 276..19 | 1290 | 100 | Minus |
Dbi-RB | 386 | CG8627-RB | 30..287 | 276..19 | 1290 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:38:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7133117..7133364 | 266..19 | 1240 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 22:38:41 has no hits.
BO16022.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:47 Download gff for
BO16022.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8627-PA | 1..261 | 15..276 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:12:47 Download gff for
BO16022.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 26..290 | 15..284 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:05:41 Download gff for
BO16022.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 26..290 | 15..284 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:05:41 Download gff for
BO16022.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7133114..7133367 | 15..271 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:12:47 Download gff for
BO16022.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7126214..7126467 | 15..271 | 98 | | Minus |
BO16022.5prime Sequence
290 bp (290 high quality bases) assembled on 2006-06-16
> BO16022.5prime
GAAGTTATCAGTCGACATGGTTTCCGAGCAATTCAACGCCGCCGCCGAGA
AGGTGAAGAGCCTGACCAAGCGTCCCAGTGATGACGAGTTCCTGCAGCTG
TACGCCCTGTTCAAGCAGGCCAGCGTTGGTGACAACGACACCGCCAAGCC
GGGTCTCCTGGACCTGAAGGGCAAGGCCAAGTGGGAGGCCTGGAACAAGC
AGAAGGGCAAGAGCAGCGAGGCCGCCCAGCAGGAGTACATCACCTTTGTG
GAGGGCCTGGTGGCCAAGTATGCCGCAAGCTTTCTAGACC
BO16022.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8627-PB | 261 | Dbi-RB | 1..258 | 17..274 | 1290 | 100 | Plus |
CG8627-PA | 261 | Dbi-RA | 1..258 | 17..274 | 1290 | 100 | Plus |
CG8498-PA | 273 | CG8498-RA | 154..185 | 167..198 | 135 | 96.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:27:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbi-RA | 420 | CG8627-RA | 64..321 | 17..274 | 1290 | 100 | Plus |
Dbi-RB | 386 | CG8627-RB | 30..287 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:26:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7133117..7133364 | 27..274 | 1240 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 04:27:00 has no hits.
BO16022.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:48 Download gff for
BO16022.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8627-PA | 1..261 | 17..278 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:28 Download gff for
BO16022.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 26..290 | 9..278 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:05:08 Download gff for
BO16022.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 26..290 | 9..278 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:05:08 Download gff for
BO16022.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7133114..7133367 | 22..278 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:28 Download gff for
BO16022.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7126214..7126467 | 22..278 | 98 | | Plus |
BO16022.complete Sequence
292 bp assembled on 2008-08-15
GenBank Submission: FJ633670
> BO16022.complete
GAAGTTATCAGTCGACATGGTTTCCGAGCAATTCAACGCCGCCGCCGAGA
AGGTGAAGAGCCTGACCAAGCGTCCCAGTGATGACGAGTTCCTGCAGCTG
TACGCCCTGTTCAAGCAGGCCAGCGTTGGTGACAACGACACCGCCAAGCC
GGGTCTCCTGGACCTGAAGGGCAAGGCCAAGTGGGAGGCCTGGAACAAGC
AGAAGGGCAAGAGCAGCGAGGCCGCCCAGCAGGAGTACATCACCTTTGTG
GAGGGCCTGGTGGCCAAGTATGCCGCAAGCTTTCTAGACCAT
BO16022.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:17:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbi-RA | 261 | CG8627-PA | 1..258 | 17..274 | 1290 | 100 | Plus |
Dbi-RB | 261 | CG8627-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbi-RA | 420 | CG8627-RA | 64..321 | 17..274 | 1290 | 100 | Plus |
Dbi-RB | 386 | CG8627-RB | 30..287 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:17:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7133117..7133364 | 27..274 | 1240 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:17:55 has no hits.
BO16022.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:27 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RA | 52..316 | 9..278 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:12 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 30..287 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:10:42 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RA | 56..313 | 17..276 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:08:03 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dbi-RB | 30..287 | 17..276 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:08:03 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7133114..7133364 | 22..276 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:12 Download gff for
BO16022.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7126214..7126464 | 22..276 | 98 | | Plus |
BO16022.pep Sequence
Translation from 16 to 292
> BO16022.pep
MVSEQFNAAAEKVKSLTKRPSDDEFLQLYALFKQASVGDNDTAKPGLLDL
KGKAKWEAWNKQKGKSSEAAQQEYITFVEGLVAKYAASFLDH
BO16022.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:40:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbi-PA | 86 | CG8627-PA | 1..86 | 1..86 | 437 | 100 | Plus |
Dbi-PB | 86 | CG8627-PB | 1..86 | 1..86 | 437 | 100 | Plus |
CG8498-PB | 90 | CG8498-PB | 5..84 | 4..83 | 251 | 58.8 | Plus |
CG8498-PA | 90 | CG8498-PA | 5..84 | 4..83 | 251 | 58.8 | Plus |
CG8629-PA | 84 | CG8629-PA | 4..84 | 6..86 | 225 | 53.1 | Plus |