Clone Sequence Records
BO16024.5prime Sequence
302 bp (302 high quality bases) assembled on 2006-06-16
> BO16024.5prime
GAAGTTATCAGTCGACATGTTGGTTAAGCACATTGTCAAGCAGGGGCTTC
TGCTCAAGAACGCTGGCGCTTTGTCGCGTGCCGCTTACCACGGTGGACAT
GGTCCCCACTCCACCATGAACGATCTGCCCGTGCCCGCTGGAGACTGGAA
GGAGCAGCACAGCCAGAAGAACGCCAAGTACAATGCCGCGCTCATCACTG
GCATTCTCGTCCTGGCCGGCACTATTGGATTCGTGAAATCTTCTGGTATC
ATCCACTTCAACTACTACGCGCCCAAGAGCCTGGACGCAAGCTTTCTAGA
CC
BO16024.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7630-PA | 273 | CG7630-RA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:14:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7630-RA | 417 | CG7630-RA | 57..327 | 16..286 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:14:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17425909..17426081 | 62..234 | 865 | 100 | Plus |
3L | 28110227 | 3L | 17426139..17426192 | 233..286 | 270 | 100 | Plus |
3L | 28110227 | 3L | 17425594..17425640 | 16..62 | 235 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 08:14:06 has no hits.
BO16024.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:48 Download gff for
BO16024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-PA | 1..273 | 17..290 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:04 Download gff for
BO16024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 51..332 | 10..292 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:39:44 Download gff for
BO16024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 51..332 | 10..292 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:39:44 Download gff for
BO16024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17425588..17425640 | 10..62 | 94 | -> | Plus |
3L | 17425910..17426079 | 63..232 | 100 | -> | Plus |
3L | 17426139..17426197 | 233..292 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:04 Download gff for
BO16024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17418688..17418740 | 10..62 | 94 | -> | Plus |
arm_3L | 17419010..17419179 | 63..232 | 100 | -> | Plus |
arm_3L | 17419239..17419297 | 233..292 | 96 | | Plus |
BO16024.complete Sequence
304 bp assembled on 2008-08-15
GenBank Submission: FJ633671
> BO16024.complete
GAAGTTATCAGTCGACATGTTGGTTAAGCACATTGTCAAGCAGGGGCTTC
TGCTCAAGAACGCTGGCGCTTTGTCGCGTGCCGCTTACCACGGTGGACAT
GGTCCCCACTCCACCATGAACGATCTGCCCGTGCCCGCTGGAGACTGGAA
GGAGCAGCACAGCCAGAAGAACGCCAAGTACAATGCCGCGCTCATCACTG
GCATTCTCGTCCTGGCCGGCACTATTGGATTCGTGAAATCTTCTGGTATC
ATCCACTTCAACTACTACGCGCCCAAGAGCCTGGACGCAAGCTTTCTAGA
CCAT
BO16024.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:07:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7630-RA | 273 | CG7630-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7630-RA | 417 | CG7630-RA | 57..327 | 16..286 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17425909..17426081 | 62..234 | 865 | 100 | Plus |
3L | 28110227 | 3L | 17426139..17426192 | 233..286 | 270 | 100 | Plus |
3L | 28110227 | 3L | 17425594..17425640 | 16..62 | 235 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:07:09 has no hits.
BO16024.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:46:45 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 40..321 | 10..292 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:44 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 63..327 | 22..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:02:46 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 52..316 | 22..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:11:39 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7630-RA | 63..327 | 22..288 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:11:39 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17425600..17425640 | 22..62 | 100 | -> | Plus |
3L | 17425910..17426079 | 63..232 | 100 | -> | Plus |
3L | 17426139..17426192 | 233..288 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:44 Download gff for
BO16024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17418700..17418740 | 22..62 | 100 | -> | Plus |
arm_3L | 17419010..17419179 | 63..232 | 100 | -> | Plus |
arm_3L | 17419239..17419292 | 233..288 | 96 | | Plus |
BO16024.pep Sequence
Translation from 16 to 304
> BO16024.pep
MLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMNDLPVPAGDWKEQHSQ
KNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAPKSLDASFLDH
BO16024.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7630-PA | 90 | CG7630-PA | 1..90 | 1..90 | 473 | 100 | Plus |
gom-PA | 305 | CG6727-PA | 70..136 | 21..87 | 149 | 38.8 | Plus |