Clone BO16024 Report

Search the DGRC for BO16024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG7630-RA
Protein status:BO16024.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO16024.5prime Sequence

302 bp (302 high quality bases) assembled on 2006-06-16

> BO16024.5prime
GAAGTTATCAGTCGACATGTTGGTTAAGCACATTGTCAAGCAGGGGCTTC
TGCTCAAGAACGCTGGCGCTTTGTCGCGTGCCGCTTACCACGGTGGACAT
GGTCCCCACTCCACCATGAACGATCTGCCCGTGCCCGCTGGAGACTGGAA
GGAGCAGCACAGCCAGAAGAACGCCAAGTACAATGCCGCGCTCATCACTG
GCATTCTCGTCCTGGCCGGCACTATTGGATTCGTGAAATCTTCTGGTATC
ATCCACTTCAACTACTACGCGCCCAAGAGCCTGGACGCAAGCTTTCTAGA
CC

BO16024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-PA 273 CG7630-RA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-RA 417 CG7630-RA 57..327 16..286 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17425909..17426081 62..234 865 100 Plus
3L 28110227 3L 17426139..17426192 233..286 270 100 Plus
3L 28110227 3L 17425594..17425640 16..62 235 100 Plus
Blast to na_te.dros performed on 2015-02-11 08:14:06 has no hits.

BO16024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:48 Download gff for BO16024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7630-PA 1..273 17..290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:04 Download gff for BO16024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 51..332 10..292 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:39:44 Download gff for BO16024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 51..332 10..292 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:39:44 Download gff for BO16024.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 17425588..17425640 10..62 94 -> Plus
3L 17425910..17426079 63..232 100 -> Plus
3L 17426139..17426197 233..292 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:04 Download gff for BO16024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17418688..17418740 10..62 94 -> Plus
arm_3L 17419010..17419179 63..232 100 -> Plus
arm_3L 17419239..17419297 233..292 96   Plus

BO16024.complete Sequence

304 bp assembled on 2008-08-15

GenBank Submission: FJ633671

> BO16024.complete
GAAGTTATCAGTCGACATGTTGGTTAAGCACATTGTCAAGCAGGGGCTTC
TGCTCAAGAACGCTGGCGCTTTGTCGCGTGCCGCTTACCACGGTGGACAT
GGTCCCCACTCCACCATGAACGATCTGCCCGTGCCCGCTGGAGACTGGAA
GGAGCAGCACAGCCAGAAGAACGCCAAGTACAATGCCGCGCTCATCACTG
GCATTCTCGTCCTGGCCGGCACTATTGGATTCGTGAAATCTTCTGGTATC
ATCCACTTCAACTACTACGCGCCCAAGAGCCTGGACGCAAGCTTTCTAGA
CCAT

BO16024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-RA 273 CG7630-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-RA 417 CG7630-RA 57..327 16..286 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17425909..17426081 62..234 865 100 Plus
3L 28110227 3L 17426139..17426192 233..286 270 100 Plus
3L 28110227 3L 17425594..17425640 16..62 235 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:07:09 has no hits.

BO16024.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:46:45 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 40..321 10..292 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:44 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 63..327 22..288 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:02:46 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 52..316 22..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:11:39 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
CG7630-RA 63..327 22..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:11:39 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17425600..17425640 22..62 100 -> Plus
3L 17425910..17426079 63..232 100 -> Plus
3L 17426139..17426192 233..288 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:44 Download gff for BO16024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17418700..17418740 22..62 100 -> Plus
arm_3L 17419010..17419179 63..232 100 -> Plus
arm_3L 17419239..17419292 233..288 96   Plus

BO16024.pep Sequence

Translation from 16 to 304

> BO16024.pep
MLVKHIVKQGLLLKNAGALSRAAYHGGHGPHSTMNDLPVPAGDWKEQHSQ
KNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYAPKSLDASFLDH

BO16024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG7630-PA 90 CG7630-PA 1..90 1..90 473 100 Plus
gom-PA 305 CG6727-PA 70..136 21..87 149 38.8 Plus