Clone BO16025 Report

Search the DGRC for BO16025

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG13779-RA
Protein status:BO16025.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16025.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16025.3prime
ATGGTCTAGAAAGCTTGCCGTTTCCATTTTCTTGCTCTCCAAATGGGCCT
TCAACTGCTGGCTGAAGTCGTCCTCCACGTTGTCGTCGTCCCAGTTGTCC
TCCCACACATTTAGCTCTTCCTCGTCGTCGCCAACGCGGAAATCTTCGGC
GGGAAACTCTTCGAACTCGTCGTCCTCCTCCAGGAGACCCAAGTCTTCGC
TCTTGTTGTTGGTCTCCTCCTTCTCTTTCTCCTTTTCCTTATCTGGGGCA
GACATGTCGACTGATAACT

BO16025.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13779-PA 240 CG13779-RA 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-RA 427 CG13779-RA 101..337 255..19 1185 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7064251..7064377 145..19 635 100 Minus
2L 23513712 2L 7064086..7064197 255..144 560 100 Minus
Blast to na_te.dros performed on 2015-02-10 18:29:16 has no hits.

BO16025.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:49 Download gff for BO16025.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13779-PA 1..240 15..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:48:46 Download gff for BO16025.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 93..340 15..263 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:59:51 Download gff for BO16025.3prime
Subject Subject Range Query Range Percent Splice Strand
Sem1-RA 93..340 15..263 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:59:51 Download gff for BO16025.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 7064078..7064197 144..263 96 -> Minus
2L 7064253..7064380 15..143 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:48:46 Download gff for BO16025.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7064078..7064197 144..263 96 -> Minus
arm_2L 7064253..7064380 15..143 98   Minus

BO16025.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16025.5prime
GAAGTTATCAGTCGACATGTCTGCCCCAGATAAGGAAAAGGAGAAAGAGA
AGGAGGAGACCAACAACAAGAGCGAAGACTTGGGTCTCCTGGAGGAGGAC
GACGAGTTCGAAGAGTTTCCCGCCGAAGATTTCCGCGTTGGCGACGACGA
GGAAGAGCTAAATGTGTGGGAGGACAACTGGGACGACGACAACGTGGAGG
ACGACTTCAGCCAGCAGTTGAAGGCCCATTTGGAGAGCAAGAAAATGGAA
ACGGCAAGCTTTCTAGACC

BO16025.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13779-PA 240 CG13779-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-RA 427 CG13779-RA 101..337 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7064251..7064377 127..253 635 100 Plus
2L 23513712 2L 7064086..7064197 17..128 560 100 Plus
Blast to na_te.dros performed on 2015-02-12 03:34:21 has no hits.

BO16025.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:49 Download gff for BO16025.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13779-PA 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:29 Download gff for BO16025.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 93..340 9..257 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:37:38 Download gff for BO16025.5prime
Subject Subject Range Query Range Percent Splice Strand
Sem1-RA 93..340 9..257 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:37:38 Download gff for BO16025.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 7064078..7064197 9..128 96 -> Plus
2L 7064253..7064380 129..257 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:29 Download gff for BO16025.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7064078..7064197 9..128 96 -> Plus
arm_2L 7064253..7064380 129..257 98   Plus

BO16025.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633672

> BO16025.complete
GAAGTTATCAGTCGACATGTCTGCCCCAGATAAGGAAAAGGAGAAAGAGA
AGGAGGAGACCAACAACAAGAGCGAAGACTTGGGTCTCCTGGAGGAGGAC
GACGAGTTCGAAGAGTTTCCCGCCGAAGATTTCCGCGTTGGCGACGACGA
GGAAGAGCTAAATGTGTGGGAGGACAACTGGGACGACGACAACGTGGAGG
ACGACTTCAGCCAGCAGTTGAAGGCCCATTTGGAGAGCAAGAAAATGGAA
ACGGCAAGCTTTCTAGACCAT

BO16025.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-RA 240 CG13779-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-RA 427 CG13779-RA 101..337 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7064251..7064377 127..253 635 100 Plus
2L 23513712 2L 7064086..7064197 17..128 560 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:18:20 has no hits.

BO16025.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:52 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 94..341 9..257 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:22:02 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 101..337 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:00:36 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
CG13779-RA 102..338 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:29:36 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
Sem1-RA 101..337 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:29:36 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7064086..7064197 17..128 100 -> Plus
2L 7064253..7064377 129..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:22:02 Download gff for BO16025.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7064086..7064197 17..128 100 -> Plus
arm_2L 7064253..7064377 129..255 98   Plus

BO16025.pep Sequence

Translation from 16 to 271

> BO16025.pep
MSAPDKEKEKEKEETNNKSEDLGLLEEDDEFEEFPAEDFRVGDDEEELNV
WEDNWDDDNVEDDFSQQLKAHLESKKMETASFLDH

BO16025.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
Sem1-PA 79 CG13779-PA 1..79 1..79 422 100 Plus