Clone Sequence Records
BO16029.3prime Sequence
185 bp (185 high quality bases) assembled on 2006-06-16
> BO16029.3prime
ATGGTCTAGAAAGCTTGCTTGCTCCAGCTCGTTGGTGGGTCCGTGGGTCA
GCTTGGCTCTCATGGAGCCGCAGACCATCATGCAGGCGAACAGGGACAGC
TCCAGGACACGGCACATGCAGTAGGCCACCACATCCACCAGGTGCTCCAC
CACTCCCAAGTACAGACACATGTCGACTGATAACT
BO16029.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-PA | 156 | CG15704-RA | 1..153 | 171..19 | 765 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:41:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-RA | 456 | CG15704-RA | 179..331 | 171..19 | 765 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:41:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16280193..16280345 | 171..19 | 765 | 100 | Minus |
Blast to na_te.dros performed 2015-02-02 14:41:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5309..5375 | 73..7 | 101 | 61.2 | Minus |
BO16029.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:51 Download gff for
BO16029.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-PA | 1..156 | 16..171 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:53:48 Download gff for
BO16029.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 170..331 | 19..179 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:23:44 Download gff for
BO16029.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 170..331 | 19..179 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:23:44 Download gff for
BO16029.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16280184..16280345 | 19..179 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:53:48 Download gff for
BO16029.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12167689..12167850 | 19..179 | 97 | | Minus |
BO16029.5prime Sequence
185 bp (185 high quality bases) assembled on 2006-06-16
> BO16029.5prime
GAAGTTATCAGTCGACATGTGTCTGTACTTGGGAGTGGTGGAGCACCTGG
TGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGAGCTGTCCCTGTTC
GCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGCTGACCCACGGACC
CACCAACGAGCTGGAGCAAGCAAGCTTTCTAGACC
BO16029.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-PA | 156 | CG15704-RA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:14:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-RA | 456 | CG15704-RA | 179..331 | 17..169 | 765 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:14:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16280193..16280345 | 17..169 | 765 | 100 | Plus |
Blast to na_te.dros performed 2015-02-11 08:14:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5309..5375 | 115..181 | 101 | 61.2 | Plus |
BO16029.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:52 Download gff for
BO16029.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-PA | 1..156 | 17..172 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:16 Download gff for
BO16029.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 170..331 | 9..169 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:40:54 Download gff for
BO16029.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 170..331 | 9..169 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:40:54 Download gff for
BO16029.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16280184..16280345 | 9..169 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:16 Download gff for
BO16029.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12167689..12167850 | 9..169 | 97 | | Plus |
BO16029.complete Sequence
187 bp assembled on 2008-08-15
GenBank Submission: FJ633674
> BO16029.complete
GAAGTTATCAGTCGACATGTGTCTGTACTTGGGAGTGGTGGAGCACCTGG
TGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGAGCTGTCCCTGTTC
GCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGCTGACCCACGGACC
CACCAACGAGCTGGAGCAAGCAAGCTTTCTAGACCAT
BO16029.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:34:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-RA | 156 | CG15704-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:34:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-RA | 456 | CG15704-RA | 179..331 | 17..169 | 765 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:34:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16280193..16280345 | 17..169 | 765 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 20:34:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5309..5375 | 115..181 | 101 | 61.2 | Plus |
BO16029.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:02 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 171..332 | 9..169 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:09 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 179..331 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:19:34 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 180..332 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:23:58 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15704-RA | 179..331 | 17..171 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:23:58 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16280193..16280345 | 17..171 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:09 Download gff for
BO16029.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12167698..12167850 | 17..171 | 98 | | Plus |
BO16029.pep Sequence
Translation from 16 to 187
> BO16029.pep
MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE
QASFLDH
BO16029.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15704-PA | 51 | CG15704-PA | 1..51 | 1..51 | 273 | 100 | Plus |