Clone BO16029 Report

Search the DGRC for BO16029

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG15704-RA
Protein status:BO16029.pep: Imported from assembly
Sequenced Size:187

Clone Sequence Records

BO16029.3prime Sequence

185 bp (185 high quality bases) assembled on 2006-06-16

> BO16029.3prime
ATGGTCTAGAAAGCTTGCTTGCTCCAGCTCGTTGGTGGGTCCGTGGGTCA
GCTTGGCTCTCATGGAGCCGCAGACCATCATGCAGGCGAACAGGGACAGC
TCCAGGACACGGCACATGCAGTAGGCCACCACATCCACCAGGTGCTCCAC
CACTCCCAAGTACAGACACATGTCGACTGATAACT

BO16029.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-PA 156 CG15704-RA 1..153 171..19 765 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-RA 456 CG15704-RA 179..331 171..19 765 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16280193..16280345 171..19 765 100 Minus
Blast to na_te.dros performed 2015-02-02 14:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5309..5375 73..7 101 61.2 Minus

BO16029.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:51 Download gff for BO16029.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-PA 1..156 16..171 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:53:48 Download gff for BO16029.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 170..331 19..179 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:23:44 Download gff for BO16029.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 170..331 19..179 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:23:44 Download gff for BO16029.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 16280184..16280345 19..179 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:53:48 Download gff for BO16029.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12167689..12167850 19..179 97   Minus

BO16029.5prime Sequence

185 bp (185 high quality bases) assembled on 2006-06-16

> BO16029.5prime
GAAGTTATCAGTCGACATGTGTCTGTACTTGGGAGTGGTGGAGCACCTGG
TGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGAGCTGTCCCTGTTC
GCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGCTGACCCACGGACC
CACCAACGAGCTGGAGCAAGCAAGCTTTCTAGACC

BO16029.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-PA 156 CG15704-RA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-RA 456 CG15704-RA 179..331 17..169 765 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16280193..16280345 17..169 765 100 Plus
Blast to na_te.dros performed 2015-02-11 08:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5309..5375 115..181 101 61.2 Plus

BO16029.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:52 Download gff for BO16029.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-PA 1..156 17..172 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:16 Download gff for BO16029.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 170..331 9..169 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:40:54 Download gff for BO16029.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 170..331 9..169 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:40:54 Download gff for BO16029.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 16280184..16280345 9..169 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:16 Download gff for BO16029.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12167689..12167850 9..169 97   Plus

BO16029.complete Sequence

187 bp assembled on 2008-08-15

GenBank Submission: FJ633674

> BO16029.complete
GAAGTTATCAGTCGACATGTGTCTGTACTTGGGAGTGGTGGAGCACCTGG
TGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGAGCTGTCCCTGTTC
GCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGCTGACCCACGGACC
CACCAACGAGCTGGAGCAAGCAAGCTTTCTAGACCAT

BO16029.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-RA 156 CG15704-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-RA 456 CG15704-RA 179..331 17..169 765 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16280193..16280345 17..169 765 100 Plus
Blast to na_te.dros performed 2014-11-27 20:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5309..5375 115..181 101 61.2 Plus

BO16029.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:02 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 171..332 9..169 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:09 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 179..331 17..171 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:19:34 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 180..332 17..171 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:23:58 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 179..331 17..171 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:23:58 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280193..16280345 17..171 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:09 Download gff for BO16029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12167698..12167850 17..171 98   Plus

BO16029.pep Sequence

Translation from 16 to 187

> BO16029.pep
MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE
QASFLDH

BO16029.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-PA 51 CG15704-PA 1..51 1..51 273 100 Plus