Clone BO16031 Report

Search the DGRC for BO16031

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG9344-RA
Protein status:BO16031.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16031.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16031.3prime
ATGGTCTAGAAAGCTTGCGACCCTCCGCTTCTGCGTGGAAATGTAGAGGA
CATTGTTGCCGCGGATGAAGGCGTCGCCGTACTTGTTCTTCAGCTGCCCA
TTCACGTACTCCTCCGTCTGCTCCAGGCAGATGTTCATGTAGCCATCCAG
ACAGGCCAGCACACCTCGATAGTCAACGCCGTTGTTCAGCTTTACGGCGA
CGGGGCGTCCGTGTATCTGATTGATGAACTGCGACAGGGCCTCTTTGCGG
GACATGTCGACTGATAACT

BO16031.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 240 CG9344-RA 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..336 255..19 1185 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977462 166..19 740 100 Minus
2R 25286936 2R 20977155..20977248 255..162 470 100 Minus
Blast to na_te.dros performed 2015-02-02 14:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 123..66 112 67.8 Minus

BO16031.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:54 Download gff for BO16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-PA 1..240 16..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:53:52 Download gff for BO16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 15..255 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:23:46 Download gff for BO16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 15..255 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:23:46 Download gff for BO16031.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 165..255 100 -> Minus
2R 20977317..20977466 15..164 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:53:52 Download gff for BO16031.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864660..16864750 165..255 100 -> Minus
arm_2R 16864822..16864971 15..164 98   Minus

BO16031.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16031.5prime
GAAGTTATCAGTCGACATGTCCCGCAAAGAGGCCCTGTCGCAGTTCATCA
ATCAGATACACGGACGCCCCGTCGCCGTAAAGCTGAACAACGGCGTTGAC
TATCGAGGTGTGCTGGCCTGTCTGGATGGCTACATGAACATCTGCCTGGA
GCAGACGGAGGAGTACGTGAATGGGCAGCTGAAGAACAAGTACGGCGACG
CCTTCATCCGCGGCAACAATGTCCTCTACATTTCCACGCAGAAGCGGAGG
GTCGCAAGCTTTCTAGACC

BO16031.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 240 CG9344-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..336 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977462 106..253 740 100 Plus
2R 25286936 2R 20977155..20977248 17..110 470 100 Plus
Blast to na_te.dros performed 2015-02-11 16:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 149..206 112 67.8 Plus

BO16031.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:56 Download gff for BO16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-PA 1..240 17..256 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:16:55 Download gff for BO16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:22:24 Download gff for BO16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:22:24 Download gff for BO16031.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 17..107 100 -> Plus
2R 20977317..20977466 108..257 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:16:55 Download gff for BO16031.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864660..16864750 17..107 100 -> Plus
arm_2R 16864822..16864971 108..257 98   Plus

BO16031.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633676

> BO16031.complete
GAAGTTATCAGTCGACATGTCCCGCAAAGAGGCCCTGTCGCAGTTCATCA
ATCAGATACACGGACGCCCCGTCGCCGTAAAGCTGAACAACGGCGTTGAC
TATCGAGGTGTGCTGGCCTGTCTGGATGGCTACATGAACATCTGCCTGGA
GCAGACGGAGGAGTACGTGAATGGGCAGCTGAAGAACAAGTACGGCGACG
CCTTCATCCGCGGCAACAATGTCCTCTACATTTCCACGCAGAAGCGGAGG
GTCGCAAGCTTTCTAGACCAT

BO16031.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 240 CG9344-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..336 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977462 106..253 740 100 Plus
2R 25286936 2R 20977155..20977248 17..110 470 100 Plus
Blast to na_te.dros performed 2014-11-27 13:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 149..206 112 67.8 Plus

BO16031.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:43:58 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:26 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..336 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:09:24 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..336 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:26:11 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..336 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:26:11 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 17..107 100 -> Plus
2R 20977317..20977462 108..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:26 Download gff for BO16031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864660..16864750 17..107 100 -> Plus
arm_2R 16864822..16864967 108..255 98   Plus

BO16031.pep Sequence

Translation from 16 to 271

> BO16031.pep
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEY
VNGQLKNKYGDAFIRGNNVLYISTQKRRVASFLDH

BO16031.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 79 CG9344-PA 1..79 1..79 412 100 Plus
SmF-PA 88 CG16792-PA 12..74 10..72 161 49.2 Plus