Clone Sequence Records
BO16036.5prime Sequence
200 bp (200 high quality bases) assembled on 2006-06-16
> BO16036.5prime
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACGCAAGCTTTCTAGACC
BO16036.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:26:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8495-PA | 171 | RpS29-RA | 1..168 | 17..184 | 840 | 100 | Plus |
| CG8495-PC | 168 | RpS29-RC | 59..165 | 78..184 | 535 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:35:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS29-RB | 1007 | CG8495-RB | 92..261 | 15..184 | 850 | 100 | Plus |
| RpS29-RA | 502 | CG8495-RA | 37..206 | 15..184 | 850 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:35:18
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 9778618..9778718 | 78..178 | 505 | 100 | Plus |
| 3R | 32079331 | 3R | 9778133..9778196 | 15..78 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 03:35:19 has no hits.
BO16036.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:43:59 Download gff for
BO16036.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8495-PA | 1..171 | 17..188 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:51 Download gff for
BO16036.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 37..209 | 15..188 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:39:01 Download gff for
BO16036.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 37..209 | 15..188 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:39:01 Download gff for
BO16036.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 9778133..9778196 | 15..78 | 100 | -> | Plus |
| 3R | 9778619..9778721 | 79..181 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:51 Download gff for
BO16036.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 5603855..5603918 | 15..78 | 100 | -> | Plus |
| arm_3R | 5604341..5604443 | 79..181 | 99 | | Plus |
BO16036.complete Sequence
202 bp assembled on 2008-08-15
GenBank Submission: FJ633679
> BO16036.complete
GAAGTTATCAGTCGACATGGGTTTCGCTACTCTCTGGTACTCGCATCCCC
GCAAATATGGCCAAGGCTCCCGATGCTGCCGTGCCTGCTCTAACCGCCAC
GGTCTGATCCGCAAGTATGGCCTTAACATCTGCCGCCAGTGCTTCAGGGA
GTACGCCAACGACATTGGCTTCAAGAAGCTGGACGCAAGCTTTCTAGACC
AT
BO16036.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:43:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS29-RB | 171 | CG8495-PB | 1..168 | 17..184 | 840 | 100 | Plus |
| RpS29-RA | 171 | CG8495-PA | 1..168 | 17..184 | 840 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:43:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS29-RB | 1007 | CG8495-RB | 92..261 | 15..184 | 850 | 100 | Plus |
| RpS29-RA | 502 | CG8495-RA | 37..206 | 15..184 | 850 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:43:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 9778618..9778718 | 78..178 | 505 | 100 | Plus |
| 3R | 32079331 | 3R | 9778133..9778196 | 15..78 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 23:43:51 has no hits.
BO16036.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:47:30 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 38..210 | 15..188 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:36:32 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 39..206 | 17..186 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:08:46 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 40..207 | 17..186 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:02 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpS29-RA | 39..206 | 17..186 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:02 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 9778135..9778196 | 17..78 | 100 | -> | Plus |
| 3R | 9778619..9778723 | 79..186 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:36:32 Download gff for
BO16036.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 5603857..5603918 | 17..78 | 100 | -> | Plus |
| arm_3R | 5604341..5604445 | 79..186 | 96 | | Plus |
BO16036.pep Sequence
Translation from 16 to 202
> BO16036.pep
MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDI
GFKKLDASFLDH
BO16036.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpS29-PB | 56 | CG8495-PB | 1..56 | 1..56 | 323 | 100 | Plus |
| RpS29-PA | 56 | CG8495-PA | 1..56 | 1..56 | 323 | 100 | Plus |
