Clone Sequence Records
BO16037.3prime Sequence
308 bp (308 high quality bases) assembled on 2006-06-16
> BO16037.3prime
ATGGTCTAGAAAGCTTGCCTGTTCCTTGGTTTCACGCAGACGACGGACGG
CGGATCGCACGGAGGCGGCGGCGGTGGTGGAGTACACCCAGGCGCCACCG
GCGACGGTCCTTTTGCAGCGCTTGCAGGACCAGATGCCCACAACGGCGCG
CTTCATGGAGTCCTTGCCGCAGAAGGAGCAAGTGTACTTGCTGTGCTGGG
TGATTTCCATCTTCTTGACCATCTTACGCAGGGAGGCACCATAACGGGTA
CCATATTTACCAACGATTCCAACCTTCTTGGTGCGCTTGGCCATGTCGAC
TGATAACT
BO16037.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:26:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG5827-PA | 279 | RpL37A-RA | 1..276 | 294..19 | 1380 | 100 | Minus |
| CG5827-PB | 279 | RpL37A-RB | 1..276 | 294..19 | 1380 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:17:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37A-RA | 511 | CG5827-RA | 84..359 | 294..19 | 1380 | 100 | Minus |
| RpL37A-RB | 583 | CG5827-RB | 156..431 | 294..19 | 1380 | 100 | Minus |
| RpL37A-RC | 705 | CG5827-RC | 127..402 | 294..19 | 1380 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:17:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 5071607..5071752 | 164..19 | 730 | 100 | Minus |
| 2L | 23513712 | 2L | 5071226..5071356 | 292..162 | 655 | 100 | Minus |
Blast to na_te.dros performed 2015-02-11 08:17:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 894..927 | 84..51 | 107 | 79.4 | Minus |
BO16037.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:00 Download gff for
BO16037.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG5827-PB | 1..279 | 15..294 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:32 Download gff for
BO16037.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 120..405 | 15..302 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:42:47 Download gff for
BO16037.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 120..405 | 15..302 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:42:47 Download gff for
BO16037.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 5071214..5071355 | 163..306 | 96 | -> | Minus |
| 2L | 5071609..5071755 | 15..162 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:32 Download gff for
BO16037.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 5071214..5071355 | 163..306 | 96 | -> | Minus |
| arm_2L | 5071609..5071755 | 15..162 | 98 | | Minus |
BO16037.5prime Sequence
308 bp (308 high quality bases) assembled on 2006-06-16
> BO16037.5prime
GAAGTTATCAGTCGACATGGCCAAGCGCACCAAGAAGGTTGGAATCGTTG
GTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAAGATGGTCAAGAAG
ATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCTTCTGCGGCAAGGA
CTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGCAAGCGCTGCAAAA
GGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCACCGCCGCCGCCTCC
GTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGGAACAGGCAAGCTT
TCTAGACC
BO16037.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:26:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG5827-PA | 279 | RpL37A-RA | 1..276 | 17..292 | 1380 | 100 | Plus |
| CG5827-PB | 279 | RpL37A-RB | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:11:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37A-RA | 511 | CG5827-RA | 84..359 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RB | 583 | CG5827-RB | 156..431 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RC | 705 | CG5827-RC | 127..402 | 17..292 | 1380 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:11:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 5071607..5071752 | 147..292 | 730 | 100 | Plus |
| 2L | 23513712 | 2L | 5071226..5071356 | 19..149 | 655 | 100 | Plus |
Blast to na_te.dros performed 2015-02-10 21:11:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 894..927 | 227..260 | 107 | 79.4 | Plus |
BO16037.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:01 Download gff for
BO16037.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG5827-PB | 1..279 | 17..296 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:26:29 Download gff for
BO16037.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 120..405 | 9..296 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:42:34 Download gff for
BO16037.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 120..405 | 9..296 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:42:34 Download gff for
BO16037.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 5071214..5071355 | 5..148 | 96 | -> | Plus |
| 2L | 5071609..5071755 | 149..296 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:26:29 Download gff for
BO16037.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 5071214..5071355 | 5..148 | 96 | -> | Plus |
| arm_2L | 5071609..5071755 | 149..296 | 98 | | Plus |
BO16037.complete Sequence
310 bp assembled on 2008-08-15
GenBank Submission: FJ633680
> BO16037.complete
GAAGTTATCAGTCGACATGGCCAAGCGCACCAAGAAGGTTGGAATCGTTG
GTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAAGATGGTCAAGAAG
ATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCTTCTGCGGCAAGGA
CTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGCAAGCGCTGCAAAA
GGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCACCGCCGCCGCCTCC
GTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGGAACAGGCAAGCTT
TCTAGACCAT
BO16037.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37A-RA | 279 | CG5827-PA | 1..276 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RB | 279 | CG5827-PB | 1..276 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RC | 279 | CG5827-PC | 1..276 | 17..292 | 1380 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37A-RA | 511 | CG5827-RA | 84..359 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RB | 583 | CG5827-RB | 156..431 | 17..292 | 1380 | 100 | Plus |
| RpL37A-RC | 705 | CG5827-RC | 127..402 | 17..292 | 1380 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:33:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 5071607..5071752 | 147..292 | 730 | 100 | Plus |
| 2L | 23513712 | 2L | 5071226..5071356 | 19..149 | 655 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 21:33:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 894..927 | 227..260 | 107 | 79.4 | Plus |
BO16037.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:43 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RB | 111..396 | 9..296 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:16 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 127..402 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:26:07 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RB | 118..393 | 17..294 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:32 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37A-RC | 127..402 | 17..294 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:32 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 5071225..5071355 | 17..148 | 99 | -> | Plus |
| 2L | 5071609..5071752 | 149..294 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:16 Download gff for
BO16037.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 5071225..5071355 | 17..148 | 99 | -> | Plus |
| arm_2L | 5071609..5071752 | 149..294 | 98 | | Plus |
BO16037.pep Sequence
Translation from 16 to 310
> BO16037.pep
MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA
VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQASFLDH
BO16037.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37A-PA | 92 | CG5827-PA | 1..92 | 1..92 | 478 | 100 | Plus |
| RpL37A-PB | 92 | CG5827-PB | 1..92 | 1..92 | 478 | 100 | Plus |
| RpL37A-PC | 92 | CG5827-PC | 1..92 | 1..92 | 478 | 100 | Plus |
