Clone BO16042 Report

Search the DGRC for BO16042

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG6878-RA
Protein status:BO16042.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16042.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16042.3prime
ATGGTCTAGAAAGCTTGCGCAGCGAATCCCCGTGCCGATGGCCATAAAGG
TGCCAAAGGTTCCGCCGCCCTGGACCATGGTCTTGCCCACGTTGTTGATC
AGCTCCCGCCCGCGTAGTCCGTATCTGAGCGCCGAGAACCCGCCAAAGAC
CGCACCGCTGGCCATGCCCACGCAGAATCCGATGATGAAGCCCGTCTTCA
TCTTATCGAAGCACGTTGGTCCCTGCTGGGAAAATGAGCTCGTAGGCAGA
GGCATGTCGACTGATAACT

BO16042.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-PA 240 CG6878-RA 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-RA 531 CG6878-RA 186..423 256..19 1190 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15162002..15162133 256..125 660 100 Minus
3L 28110227 3L 15162255..15162362 126..19 540 100 Minus
Blast to na_te.dros performed on 2015-02-11 08:17:53 has no hits.

BO16042.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:06 Download gff for BO16042.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-PA 1..240 16..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:52:42 Download gff for BO16042.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 181..430 12..262 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:43:42 Download gff for BO16042.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 181..430 12..262 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:43:42 Download gff for BO16042.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 15161997..15162133 125..262 98 -> Minus
3L 15162257..15162369 12..124 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:52:42 Download gff for BO16042.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15155097..15155233 125..262 98 -> Minus
arm_3L 15155357..15155469 12..124 96   Minus

BO16042.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16042.5prime
GAAGTTATCAGTCGACATGCCTCTGCCTACGAGCTCATTTTCCCAGCAGG
GACCAACGTGCTTCGATAAGATGAAGACGGGCTTCATCATCGGATTCTGC
GTGGGCATGGCCAGCGGTGCGGTCTTTGGCGGGTTCTCGGCGCTCAGATA
CGGACTACGCGGGCGGGAGCTGATCAACAACGTGGGCAAGACCATGGTCC
AGGGCGGCGGAACCTTTGGCACCTTTATGGCCATCGGCACGGGGATTCGC
TGCGCAAGCTTTCTAGACC

BO16042.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-PA 240 CG6878-RA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-RA 531 CG6878-RA 186..423 16..253 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15162002..15162133 16..147 660 100 Plus
3L 28110227 3L 15162255..15162362 146..253 540 100 Plus
Blast to na_te.dros performed on 2015-02-06 12:31:29 has no hits.

BO16042.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:06 Download gff for BO16042.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-PA 1..240 17..256 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:11:39 Download gff for BO16042.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 181..430 10..260 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:40:43 Download gff for BO16042.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 181..430 10..260 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:40:43 Download gff for BO16042.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 15161997..15162133 10..147 98 -> Plus
3L 15162257..15162369 148..260 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:11:39 Download gff for BO16042.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15155097..15155233 10..147 98 -> Plus
arm_3L 15155357..15155469 148..260 96   Plus

BO16042.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633683

> BO16042.complete
GAAGTTATCAGTCGACATGCCTCTGCCTACGAGCTCATTTTCCCAGCAGG
GACCAACGTGCTTCGATAAGATGAAGACGGGCTTCATCATCGGATTCTGC
GTGGGCATGGCCAGCGGTGCGGTCTTTGGCGGGTTCTCGGCGCTCAGATA
CGGACTACGCGGGCGGGAGCTGATCAACAACGTGGGCAAGACCATGGTCC
AGGGCGGCGGAACCTTTGGCACCTTTATGGCCATCGGCACGGGGATTCGC
TGCGCAAGCTTTCTAGACCAT

BO16042.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-RA 240 CG6878-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-RA 531 CG6878-RA 186..423 16..253 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15162002..15162133 16..147 660 100 Plus
3L 28110227 3L 15162255..15162362 146..253 540 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:59:53 has no hits.

BO16042.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:35:51 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 183..432 10..260 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:04:12 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 187..423 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:01:42 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 189..425 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:40 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 187..423 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:40 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15162003..15162133 17..147 100 -> Plus
3L 15162257..15162362 148..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:04:12 Download gff for BO16042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15155103..15155233 17..147 100 -> Plus
arm_3L 15155357..15155462 148..255 98   Plus

BO16042.pep Sequence

Translation from 16 to 271

> BO16042.pep
MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGR
ELINNVGKTMVQGGGTFGTFMAIGTGIRCASFLDH

BO16042.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-PA 79 CG6878-PA 1..79 1..79 420 100 Plus