Clone BO16046 Report

Search the DGRC for BO16046

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:46
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO16046.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO16046.5prime Sequence

245 bp (245 high quality bases) assembled on 2006-06-16

> BO16046.5prime
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAAGCAAGCTTTCTAGACC

BO16046.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32714-PA 216 CG32714-RA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..486 17..229 1065 100 Plus
CG33181-RI 3920 CG33181-RI 176..371 34..229 980 100 Plus
CG33181-RH 4107 CG33181-RH 285..480 34..229 980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509651 33..229 985 100 Plus
Blast to na_te.dros performed on 2015-02-08 12:00:20 has no hits.

BO16046.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:12 Download gff for BO16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32714-PA 1..216 17..233 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:18:03 Download gff for BO16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..489 14..233 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:35:35 Download gff for BO16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..489 14..233 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:35:35 Download gff for BO16046.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8489618..8489637 14..33 95 -> Plus
X 8509456..8509654 34..233 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:18:03 Download gff for BO16046.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383651..8383670 14..33 95 -> Plus
arm_X 8403489..8403687 34..233 99   Plus

BO16046.3prime Sequence

245 bp (245 high quality bases) assembled on 2006-06-16

> BO16046.3prime
ATGGTCTAGAAAGCTTGCTTGAAAATGTGGGAAATGTTGGGGCGCCGTGT
GTCTGTCGCAGGATGTGTGCGTCGTAATGTCCGTGGTTTTTGGGGGCCAG
GATGTCGTACTACTGGGGATAGTGAGAGGTAGTAGGTAGTAGGTAGTAGG
TAGAAGGACTGAGGCTGAGGTCGAGGTTGAGAGGTTGAGCTTAGTCACCG
GACCGTTGATATGGCAACTCCATTGATTCATGTCGACTGATAACT

BO16046.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32714-PA 216 CG32714-RA 1..213 231..19 1065 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..486 231..19 1065 100 Minus
CG33181-RI 3920 CG33181-RI 176..371 214..19 980 100 Minus
CG33181-RH 4107 CG33181-RH 285..480 214..19 980 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509651 215..19 985 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:17:39 has no hits.

BO16046.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:11 Download gff for BO16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32714-PA 1..216 15..231 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 16:59:52 Download gff for BO16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..489 15..234 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:02:18 Download gff for BO16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..489 15..234 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:02:18 Download gff for BO16046.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8489618..8489637 215..234 95 -> Minus
X 8509456..8509654 15..214 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 16:59:52 Download gff for BO16046.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383651..8383670 215..234 95 -> Minus
arm_X 8403489..8403687 15..214 99   Minus

BO16046.complete Sequence

247 bp assembled on 2008-08-15

> BO16046.complete
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAAGCAAGCTTTCTAGACCAT

BO16046.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 00:42:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..486 17..229 1065 100 Plus
CG33181-RI 3920 CG33181-RI 176..371 34..229 980 100 Plus
CG33181-RH 4107 CG33181-RH 285..480 34..229 980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509651 33..229 985 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:42:00 has no hits.

BO16046.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:44 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 270..488 14..233 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:29:49 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 274..486 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:08:53 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 273..485 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:36:29 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 274..486 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:36:29 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
X 8489621..8489637 17..33 100 -> Plus
X 8509456..8509651 34..231 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:29:49 Download gff for BO16046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383654..8383670 17..33 100 -> Plus
arm_X 8403489..8403684 34..231 98   Plus

BO16046.pep Sequence

Translation from 16 to 247

> BO16046.pep
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQASFLDH
Sequence BO16046.pep has no blast hits.