Clone Sequence Records
BO16046.5prime Sequence
245 bp (245 high quality bases) assembled on 2006-06-16
> BO16046.5prime
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAAGCAAGCTTTCTAGACC
BO16046.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32714-PA | 216 | CG32714-RA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:00:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33181-RF | 4113 | CG32714-RF | 274..486 | 17..229 | 1065 | 100 | Plus |
CG33181-RI | 3920 | CG33181-RI | 176..371 | 34..229 | 980 | 100 | Plus |
CG33181-RH | 4107 | CG33181-RH | 285..480 | 34..229 | 980 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:00:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 8509455..8509651 | 33..229 | 985 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-08 12:00:20 has no hits.
BO16046.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:12 Download gff for
BO16046.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32714-PA | 1..216 | 17..233 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:18:03 Download gff for
BO16046.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 271..489 | 14..233 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:35:35 Download gff for
BO16046.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 271..489 | 14..233 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:35:35 Download gff for
BO16046.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489618..8489637 | 14..33 | 95 | -> | Plus |
X | 8509456..8509654 | 34..233 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:18:03 Download gff for
BO16046.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 8383651..8383670 | 14..33 | 95 | -> | Plus |
arm_X | 8403489..8403687 | 34..233 | 99 | | Plus |
BO16046.3prime Sequence
245 bp (245 high quality bases) assembled on 2006-06-16
> BO16046.3prime
ATGGTCTAGAAAGCTTGCTTGAAAATGTGGGAAATGTTGGGGCGCCGTGT
GTCTGTCGCAGGATGTGTGCGTCGTAATGTCCGTGGTTTTTGGGGGCCAG
GATGTCGTACTACTGGGGATAGTGAGAGGTAGTAGGTAGTAGGTAGTAGG
TAGAAGGACTGAGGCTGAGGTCGAGGTTGAGAGGTTGAGCTTAGTCACCG
GACCGTTGATATGGCAACTCCATTGATTCATGTCGACTGATAACT
BO16046.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:27:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32714-PA | 216 | CG32714-RA | 1..213 | 231..19 | 1065 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:17:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33181-RF | 4113 | CG32714-RF | 274..486 | 231..19 | 1065 | 100 | Minus |
CG33181-RI | 3920 | CG33181-RI | 176..371 | 214..19 | 980 | 100 | Minus |
CG33181-RH | 4107 | CG33181-RH | 285..480 | 214..19 | 980 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:17:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 8509455..8509651 | 215..19 | 985 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:17:39 has no hits.
BO16046.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:11 Download gff for
BO16046.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32714-PA | 1..216 | 15..231 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 16:59:52 Download gff for
BO16046.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 271..489 | 15..234 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:02:18 Download gff for
BO16046.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 271..489 | 15..234 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:02:18 Download gff for
BO16046.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489618..8489637 | 215..234 | 95 | -> | Minus |
X | 8509456..8509654 | 15..214 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 16:59:52 Download gff for
BO16046.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 8383651..8383670 | 215..234 | 95 | -> | Minus |
arm_X | 8403489..8403687 | 15..214 | 99 | | Minus |
BO16046.complete Sequence
247 bp assembled on 2008-08-15
> BO16046.complete
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAAGCAAGCTTTCTAGACCAT
BO16046.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 00:42:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:42:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33181-RF | 4113 | CG32714-RF | 274..486 | 17..229 | 1065 | 100 | Plus |
CG33181-RI | 3920 | CG33181-RI | 176..371 | 34..229 | 980 | 100 | Plus |
CG33181-RH | 4107 | CG33181-RH | 285..480 | 34..229 | 980 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:41:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 8509455..8509651 | 33..229 | 985 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:42:00 has no hits.
BO16046.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:44 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 270..488 | 14..233 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:29:49 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 274..486 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:08:53 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 273..485 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:36:29 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33181-RF | 274..486 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:36:29 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 8489621..8489637 | 17..33 | 100 | -> | Plus |
X | 8509456..8509651 | 34..231 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:29:49 Download gff for
BO16046.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 8383654..8383670 | 17..33 | 100 | -> | Plus |
arm_X | 8403489..8403684 | 34..231 | 98 | | Plus |
BO16046.pep Sequence
Translation from 16 to 247
> BO16046.pep
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQASFLDH
Sequence BO16046.pep has no blast hits.