Clone BO16048 Report

Search the DGRC for BO16048

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG7646-RB
Protein status:BO16048.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO16048.3prime Sequence

266 bp (266 high quality bases) assembled on 2006-06-16

> BO16048.3prime
ATGGTCTAGAAAGCTTGCTGGTGCCAACATTTTTGACAACTCCTCATCTT
GCAAGCATCCTTTCAAGAACTCATCTTGGGTTAATTGACCATCGTTATTT
TCGTCCATTTTTGCAAAAATATTTTTTGCTCTTTCTTCTGCTGAATCAGC
TGGACGATTAGATGAGCACGCTCCTAGCATGTCATAAATTGCCTGAACAA
TTTTGGTCATTTCTTGTATGTCTATAACACCATTGCCATCGACATCGTAC
ATGTCGACTGATAACT

BO16048.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PA 561 CG7646-RA 325..558 252..19 1170 100 Minus
CG7646-PB 237 CG7646-RB 1..234 252..19 1170 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1229 252..19 1170 100 Minus
CG7646-RB 627 CG7646-RB 284..517 252..19 1170 100 Minus
CG7646-RA 970 CG7646-RA 627..860 252..19 1170 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995802 196..19 890 100 Minus
3L 28110227 3L 19995443..19995503 252..192 305 100 Minus
Blast to na_te.dros performed on 2015-02-12 03:36:47 has no hits.

BO16048.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:14 Download gff for BO16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-PB 1..237 15..252 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:40:19 Download gff for BO16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..863 15..257 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:40:45 Download gff for BO16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..863 15..257 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:40:45 Download gff for BO16048.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 19995439..19995502 193..257 98 -> Minus
3L 19995629..19995805 15..192 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:40:19 Download gff for BO16048.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988539..19988602 193..257 98 -> Minus
arm_3L 19988729..19988905 15..192 98   Minus

BO16048.5prime Sequence

266 bp (266 high quality bases) assembled on 2006-06-16

> BO16048.5prime
GAAGTTATCAGTCGACATGTACGATGTCGATGGCAATGGTGTTATAGACA
TACAAGAAATGACCAAAATTGTTCAGGCAATTTATGACATGCTAGGAGCG
TGCTCATCTAATCGTCCAGCTGATTCAGCAGAAGAAAGAGCAAAAAATAT
TTTTGCAAAAATGGACGAAAATAACGATGGTCAATTAACCCAAGATGAGT
TCTTGAAAGGATGCTTGCAAGATGAGGAGTTGTCAAAAATGTTGGCACCA
GCAAGCTTTCTAGACC

BO16048.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PA 561 CG7646-RA 325..558 17..250 1170 100 Plus
CG7646-PB 237 CG7646-RB 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1229 17..250 1170 100 Plus
CG7646-RB 627 CG7646-RB 284..517 17..250 1170 100 Plus
CG7646-RA 970 CG7646-RA 627..860 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995802 73..250 890 100 Plus
3L 28110227 3L 19995443..19995503 17..77 305 100 Plus
Blast to na_te.dros performed on 2015-02-02 14:45:24 has no hits.

BO16048.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:15 Download gff for BO16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-PB 1..237 17..254 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:54:35 Download gff for BO16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..863 12..254 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:24:20 Download gff for BO16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..863 12..254 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:24:20 Download gff for BO16048.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 19995439..19995502 12..76 98 -> Plus
3L 19995629..19995805 77..254 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:54:35 Download gff for BO16048.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988539..19988602 12..76 98 -> Plus
arm_3L 19988729..19988905 77..254 98   Plus

BO16048.complete Sequence

268 bp assembled on 2008-08-15

GenBank Submission: FJ633687

> BO16048.complete
GAAGTTATCAGTCGACATGTACGATGTCGATGGCAATGGTGTTATAGACA
TACAAGAAATGACCAAAATTGTTCAGGCAATTTATGACATGCTAGGAGCG
TGCTCATCTAATCGTCCAGCTGATTCAGCAGAAGAAAGAGCAAAAAATAT
TTTTGCAAAAATGGACGAAAATAACGATGGTCAATTAACCCAAGATGAGT
TCTTGAAAGGATGCTTGCAAGATGAGGAGTTGTCAAAAATGTTGGCACCA
GCAAGCTTTCTAGACCAT

BO16048.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 561 CG7646-PC 325..558 17..250 1170 100 Plus
CG7646-RB 237 CG7646-PB 1..234 17..250 1170 100 Plus
CG7646-RA 561 CG7646-PA 325..558 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1229 17..250 1170 100 Plus
CG7646-RB 627 CG7646-RB 284..517 17..250 1170 100 Plus
CG7646-RA 970 CG7646-RA 627..860 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995802 73..250 890 100 Plus
3L 28110227 3L 19995443..19995503 17..77 305 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:23:30 has no hits.

BO16048.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:55 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 321..561 12..254 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:44 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 627..860 17..252 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:25:11 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 325..558 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:10:23 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 627..860 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:10:23 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19995629..19995802 77..252 98   Plus
3L 19995443..19995502 17..76 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:44 Download gff for BO16048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988543..19988602 17..76 100 -> Plus
arm_3L 19988729..19988902 77..252 98   Plus

BO16048.pep Sequence

Translation from 16 to 268

> BO16048.pep
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMD
ENNDGQLTQDEFLKGCLQDEELSKMLAPASFLDH

BO16048.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PB 78 CG7646-PB 1..78 1..78 402 100 Plus
CG7646-PC 186 CG7646-PC 109..186 1..78 402 100 Plus
CG7646-PA 186 CG7646-PA 109..186 1..78 402 100 Plus
Nca-PA 190 CG7641-PA 107..183 1..76 163 44.9 Plus
CG44422-PE 363 CG44422-PE 280..357 1..77 158 38.5 Plus