Clone BO16051 Report

Search the DGRC for BO16051

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG30458-RA
Protein status:BO16051.pep: Imported from assembly
Sequenced Size:469

Clone Sequence Records

BO16051.5prime Sequence

467 bp (467 high quality bases) assembled on 2006-06-16

> BO16051.5prime
GAAGTTATCAGTCGACATGAAATTCCTTATCATTGCCGTCGCCTTCTTGG
CCTGCGCCTACGCTGATGTTTCCGAGCCGGCTGCCGGAGGATACGATTAC
CCCCAGCCCGCTCCACCGGCGCCTGTGAAGAGCTACATTCCCCCACCGCC
ACCACCACCCCCACCAGCACCCAAGAACACCTACATTCCTCCCCCGGCTG
CTCCTGCCAAGGCCTACATCCCACCCCCACCACCACCACCACCACCGGCG
CCAAAGAACACCTACATCCCTCCAGCACCGGCTCCAGTTGCTCCCGTGGA
GACCTACATCCCTCCCGCAGCCCCAGCCCCCGCCTACATCCCACCCGCTC
CTGTCCAGGCCGAGGAGCCCATCATCGAGGAGATCGAGCAGCCAGCCCAG
GACGGCTACCGCTACAAGACCGTCCGTCGCCGCGTCTTCCGTCACCGCAA
CGCAAGCTTTCTAGACC

BO16051.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30458-PA 438 CG30458-RA 1..435 17..451 2175 100 Plus
CG17290-PA 300 CG17290-RA 181..297 335..451 460 95.7 Plus
CG17290-PA 300 CG17290-RA 1..41 17..57 155 95.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30458-RA 614 CG30458-RA 57..491 17..451 2175 100 Plus
CG17290-RC 2443 CG17290-RC 259..450 260..451 660 89.6 Plus
CG17290-RA 440 CG17290-RA 151..342 260..451 660 89.6 Plus
CG17290-RC 2443 CG17290-RC 153..214 16..77 205 88.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17158448..17158880 451..19 2165 100 Minus
2R 25286936 2R 17154941..17155132 260..451 660 89.6 Plus
2R 25286936 2R 17154838..17154896 19..77 190 88.1 Plus
Blast to na_te.dros performed on 2015-02-08 12:01:26 has no hits.

BO16051.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:17 Download gff for BO16051.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30458-PA 1..438 17..455 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:18:12 Download gff for BO16051.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 49..495 8..456 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:35:45 Download gff for BO16051.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 49..495 8..456 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:35:45 Download gff for BO16051.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17158444..17158885 12..456 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:18:12 Download gff for BO16051.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13045949..13046390 12..456 98   Minus

BO16051.complete Sequence

469 bp assembled on 2008-08-15

GenBank Submission: FJ633689

> BO16051.complete
GAAGTTATCAGTCGACATGAAATTCCTTATCATTGCCGTCGCCTTCTTGG
CCTGCGCCTACGCTGATGTTTCCGAGCCGGCTGCCGGAGGATACGATTAC
CCCCAGCCCGCTCCACCGGCGCCTGTGAAGAGCTACATTCCCCCACCGCC
ACCACCACCCCCACCAGCACCCAAGAACACCTACATTCCTCCCCCGGCTG
CTCCTGCCAAGGCCTACATCCCACCCCCACCACCACCACCACCACCGGCG
CCAAAGAACACCTACATCCCTCCAGCACCGGCTCCAGTTGCTCCCGTGGA
GACCTACATCCCTCCCGCAGCCCCAGCCCCCGCCTACATCCCACCCGCTC
CTGTCCAGGCCGAGGAGCCCATCATCGAGGAGATCGAGCAGCCAGCCCAG
GACGGCTACCGCTACAAGACCGTCCGTCGCCGCGTCTTCCGTCACCGCAA
CGCAAGCTTTCTAGACCAT

BO16051.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30458-RA 438 CG30458-PA 1..435 17..451 2175 100 Plus
CG17290-RC 300 CG17290-PC 106..297 260..451 660 89.6 Plus
CG17290-RA 300 CG17290-PA 106..297 260..451 660 89.6 Plus
CG17290-RC 300 CG17290-PC 1..61 17..77 200 88.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30458-RA 614 CG30458-RA 57..491 17..451 2175 100 Plus
CG17290-RC 2443 CG17290-RC 259..450 260..451 660 89.6 Plus
CG17290-RA 440 CG17290-RA 151..342 260..451 660 89.6 Plus
CG17290-RC 2443 CG17290-RC 153..214 16..77 205 88.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17158448..17158880 451..19 2165 100 Minus
2R 25286936 2R 17154941..17155132 260..451 660 89.6 Plus
2R 25286936 2R 17154838..17154896 19..77 190 88.1 Plus
Blast to na_te.dros performed on 2014-11-27 17:00:39 has no hits.

BO16051.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:26 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 42..488 8..456 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:05 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 57..491 17..453 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:14:22 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 50..484 17..453 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:19 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
CG30458-RA 57..491 17..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:32:19 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17158446..17158881 17..453 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:05 Download gff for BO16051.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13045951..13046386 17..453 99   Minus

BO16051.pep Sequence

Translation from 16 to 469

> BO16051.pep
MKFLIIAVAFLACAYADVSEPAAGGYDYPQPAPPAPVKSYIPPPPPPPPP
APKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPP
AAPAPAYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRRVFRHRNASFLD
H

BO16051.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG30458-PA 145 CG30458-PA 1..145 1..145 806 100 Plus
CG17290-PC 99 CG17290-PC 1..99 1..145 368 57.2 Plus
CG17290-PA 99 CG17290-PA 1..99 1..145 368 57.2 Plus
CG30457-PA 189 CG30457-PA 1..187 1..142 323 43.8 Plus
CG10953-PB 278 CG10953-PB 112..277 16..144 293 47.3 Plus