Clone BO16052 Report

Search the DGRC for BO16052

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptFis1-RA
Protein status:BO16052.pep: Imported from assembly
Sequenced Size:328

Clone Sequence Records

BO16052.complete Sequence

328 bp assembled on 2008-11-10

GenBank Submission: KX794261

> BO16052.complete
GAAGTTATCAGTCGACATGATTTTGGAGGAACTGGCTCGTACGCATCCAG
ATGGAAGGCGTGACTATATATATTATCTTGCGTTTGGTAATGCTCGTATC
AAGGAGTATACGTCTGGCTTAAAATACTGCCGAGCTTTTCTTGACATCGA
GTCAAATGATCAAGTTCGCTCCCTAGAGGAATATATTAAAAAAGAAATCG
ATAAGGAAGTGGCAAAGGGTATGGTGGTTGCAGGCGGAGCAGCTTTAGTA
CTTGGCGGAATATTAGGACTTGGCATTGCTATGGCTAGAAATAAACAAAA
ACGGGAGAAAGCAAGCTTTCTAGACCAT

BO16052.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 297 CG17510-PG 1..294 17..310 1470 100 Plus
Fis1-RC 465 CG17510-PC 169..462 17..310 1470 100 Plus
Fis1-RA 297 CG17510-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 557 CG17510-RG 108..401 17..310 1470 100 Plus
Fis1-RC 698 CG17510-RC 249..542 17..310 1470 100 Plus
Fis1-RA 630 CG17510-RA 181..474 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5604243..5604405 179..17 815 100 Minus
2R 25286936 2R 5603900..5604014 291..177 575 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:59:46 has no hits.

BO16052.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:06 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 243..536 17..310 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:52 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..474 17..312 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:27:39 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 243..536 17..312 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:12:22 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..474 17..312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:12:22 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5603900..5604012 179..291 100 <- Minus
2R 5604244..5604405 17..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:52 Download gff for BO16052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491405..1491517 179..291 100 <- Minus
arm_2R 1491749..1491910 17..178 100   Minus

BO16052.5prime Sequence

326 bp (326 high quality bases) assembled on 2006-06-16

> BO16052.5prime
GAAGTTATCAGTCGACATGATTTTGGAGGAACTGGCTCGTACGCATCCAG
ATGGAAGGCGTGACTATATATATTATCTTGCGTTTGGTAATGCTCGTATC
AAGGAGTATACGTCTGGCTTAAAATACTGCCGAGCTTTTCTTGACATCGA
GTCAAATGATCAAGTTCGCTCCCTAGAGGAATATATTAAAAAAGAAATCG
ATAAGGAAGTGGCAAAGGGTATGGTGGTTGCAGGCGGAGCAGCTTTAGTA
CTTGGCGGAATATTAGGACTTGGCATTGCTATGGCTAGAAATAAACAAAA
ACGGGAGAAAGCAAGCTTTCTAGACC

BO16052.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17510-PA 297 CG17510-RA 1..294 17..310 1470 100 Plus
CG17510-PB 279 CG17510-RB 1..275 17..291 1375 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 06:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 557 CG17510-RG 108..401 17..310 1470 100 Plus
Fis1-RC 698 CG17510-RC 249..542 17..310 1470 100 Plus
Fis1-RA 630 CG17510-RA 181..474 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 06:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5604243..5604405 179..17 815 100 Minus
2R 25286936 2R 5603900..5604014 291..177 575 100 Minus
Blast to na_te.dros performed on 2015-01-31 06:36:06 has no hits.

BO16052.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:18 Download gff for BO16052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17510-PA 1..297 17..311 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 22:11:07 Download gff for BO16052.5prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..474 17..310 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 07:42:55 Download gff for BO16052.5prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..474 17..310 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 07:42:55 Download gff for BO16052.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 5603900..5604012 179..291 100 <- Minus
2R 5604244..5604405 17..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 22:11:07 Download gff for BO16052.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491405..1491517 179..291 100 <- Minus
arm_2R 1491749..1491910 17..178 100   Minus

BO16052.pep Sequence

Translation from 16 to 328

> BO16052.pep
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQV
RSLEEYIKKEIDKEVAKGMVVAGGAALVLGGILGLGIAMARNKQKREKAS
FLDH

BO16052.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-PG 98 CG17510-PG 1..98 1..98 495 100 Plus
Fis1-PA 98 CG17510-PA 1..98 1..98 495 100 Plus
Fis1-PC 154 CG17510-PC 57..154 1..98 495 100 Plus
Fis1-PF 92 CG17510-PF 1..91 1..91 459 100 Plus
Fis1-PD 92 CG17510-PD 1..91 1..91 459 100 Plus