Clone BO16053 Report

Search the DGRC for BO16053

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG11825-RA
Protein status:BO16053.pep: Imported from assembly
Sequenced Size:334

Clone Sequence Records

BO16053.3prime Sequence

332 bp (332 high quality bases) assembled on 2006-06-16

> BO16053.3prime
ATGGTCTAGAAAGCTTGCTTCGTCTGGCCTGGTATTGCTTTTCGGTTCCT
CGTGGAGCAGGTACTCCTTGGCCATGGTGTACGCCAATCCGGCTGTCAAA
CATCCAACGACGGTTCCCTGGGCAGCCACACGCAACTGCATCAGAAAGAC
GCTGGTGCTCATGCTGCCTCGGTTCCGATATTTGTAGGCTCCAATCAAAC
CTGCGGCCACGAATCCGGCAATACCCACCAGCATAAAGGGGGACTCCTTC
ACTTTTCGGGATAACTTGTTTGCCTGAGCGACATCTTCGTCGGTTTCGAA
TAGAGAATTGGAACTCATGTCGACTGATAACT

BO16053.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-PA 303 CG11825-RA 1..300 318..19 1500 100 Minus
CG17734-PB 288 CG17734-RB 157..219 162..100 165 90.4 Minus
CG17734-PA 306 CG17734-RA 157..219 162..100 165 90.4 Minus
CG17734-PB 288 CG17734-RB 79..149 240..170 155 88.7 Minus
CG17734-PA 306 CG17734-RA 79..149 240..170 155 88.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-RC 1218 CG11825-RC 687..986 318..19 1500 100 Minus
CG11825-RA 598 CG11825-RA 67..366 318..19 1500 100 Minus
CG11825-RD 1068 CG11825-RD 569..836 286..19 1340 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10420704..10421003 19..318 1500 100 Plus
3R 32079331 3R 11242837..11243014 48..225 500 85.4 Plus
3R 32079331 3R 11243780..11243875 223..318 210 81.2 Plus
Blast to na_te.dros performed on 2015-02-11 16:04:09 has no hits.

BO16053.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:19 Download gff for BO16053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:17:38 Download gff for BO16053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 62..369 15..323 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:23:01 Download gff for BO16053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 62..369 15..323 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:23:01 Download gff for BO16053.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10420700..10421008 15..323 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:17:38 Download gff for BO16053.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6308205..6308513 15..323 98   Plus

BO16053.5prime Sequence

332 bp (332 high quality bases) assembled on 2006-06-16

> BO16053.5prime
GAAGTTATCAGTCGACATGAGTTCCAATTCTCTATTCGAAACCGACGAAG
ATGTCGCTCAGGCAAACAAGTTATCCCGAAAAGTGAAGGAGTCCCCCTTT
ATGCTGGTGGGTATTGCCGGATTCGTGGCCGCAGGTTTGATTGGAGCCTA
CAAATATCGGAACCGAGGCAGCATGAGCACCAGCGTCTTTCTGATGCAGT
TGCGTGTGGCTGCCCAGGGAACCGTCGTTGGATGTTTGACAGCCGGATTG
GCGTACACCATGGCCAAGGAGTACCTGCTCCACGAGGAACCGAAAAGCAA
TACCAGGCCAGACGAAGCAAGCTTTCTAGACC

BO16053.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-PA 303 CG11825-RA 1..300 17..316 1500 100 Plus
CG17734-PB 288 CG17734-RB 157..219 173..235 165 90.4 Plus
CG17734-PA 306 CG17734-RA 157..219 173..235 165 90.4 Plus
CG17734-PB 288 CG17734-RB 79..149 95..165 155 88.7 Plus
CG17734-PA 306 CG17734-RA 79..149 95..165 155 88.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 04:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-RC 1218 CG11825-RC 687..986 17..316 1500 100 Plus
CG11825-RA 598 CG11825-RA 67..366 17..316 1500 100 Plus
CG11825-RD 1068 CG11825-RD 569..836 49..316 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 04:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10420704..10421003 316..17 1500 100 Minus
3R 32079331 3R 11242837..11243014 287..110 500 85.4 Minus
3R 32079331 3R 11243780..11243875 112..17 210 81.2 Minus
Blast to na_te.dros performed on 2015-02-03 04:52:26 has no hits.

BO16053.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:21 Download gff for BO16053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-PA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:12:28 Download gff for BO16053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 62..369 12..320 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:25:32 Download gff for BO16053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 62..369 12..320 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:25:32 Download gff for BO16053.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10420700..10421008 12..320 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:12:28 Download gff for BO16053.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6308205..6308513 12..320 98   Minus

BO16053.complete Sequence

334 bp assembled on 2008-08-15

GenBank Submission: FJ633690

> BO16053.complete
GAAGTTATCAGTCGACATGAGTTCCAATTCTCTATTCGAAACCGACGAAG
ATGTCGCTCAGGCAAACAAGTTATCCCGAAAAGTGAAGGAGTCCCCCTTT
ATGCTGGTGGGTATTGCCGGATTCGTGGCCGCAGGTTTGATTGGAGCCTA
CAAATATCGGAACCGAGGCAGCATGAGCACCAGCGTCTTTCTGATGCAGT
TGCGTGTGGCTGCCCAGGGAACCGTCGTTGGATGTTTGACAGCCGGATTG
GCGTACACCATGGCCAAGGAGTACCTGCTCCACGAGGAACCGAAAAGCAA
TACCAGGCCAGACGAAGCAAGCTTTCTAGACCAT

BO16053.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-RC 411 CG11825-PC 109..408 17..316 1500 100 Plus
CG11825-RA 303 CG11825-PA 1..300 17..316 1500 100 Plus
CG11825-RD 219 CG11825-PD 1..216 101..316 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-RC 1218 CG11825-RC 687..986 17..316 1500 100 Plus
CG11825-RA 598 CG11825-RA 67..366 17..316 1500 100 Plus
CG11825-RD 1068 CG11825-RD 569..836 49..316 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10420704..10421003 316..17 1500 100 Minus
3R 32079331 3R 11242837..11243014 287..110 500 85.4 Minus
3R 32079331 3R 11243780..11243875 112..17 210 81.2 Minus
Blast to na_te.dros performed on 2014-11-28 00:11:33 has no hits.

BO16053.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:36:01 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 60..367 12..320 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:19:36 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 67..366 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:09:30 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 65..364 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:27:43 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 67..366 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:27:43 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10420702..10421003 17..318 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:19:36 Download gff for BO16053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6308207..6308508 17..318 99   Minus

BO16053.pep Sequence

Translation from 16 to 334

> BO16053.pep
MSSNSLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNR
GSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
ASFLDH

BO16053.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-PA 100 CG11825-PA 1..100 1..100 500 100 Plus
CG11825-PC 136 CG11825-PC 37..136 1..100 500 100 Plus
CG17734-PA 101 CG17734-PA 1..97 1..97 411 83.5 Plus
CG17734-PB 95 CG17734-PB 1..93 1..93 398 84.9 Plus
CG11825-PD 72 CG11825-PD 1..72 29..100 363 100 Plus