Clone Sequence Records
BO16055.3prime Sequence
269 bp (269 high quality bases) assembled on 2006-06-16
> BO16055.3prime
ATGGTCTAGAAAGCTTGCGTTGGTGTTATTCGCGGCTCGCGCCTGCAGAT
GCTGCTGCTCTTCCACGTAGTTCTTCGCCTGGCGGCGCTTAAAAGTGCGG
TAGAAATTGGTCTCGCCCACTGTCCAATTGATCATGGAGAATTCCAGGCC
GGCGCCCAGTAAAAAGAAGAGCGGCAGGAAGCGGTAGACACCGAAGCGCT
TCTTTCCTGGCCAACTGTCCAGCAGACGACGCACGGATCCGCTGTACGGA
CTCATGTCGACTGATAACT
BO16055.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32736-PA | 240 | CG32736-RA | 1..237 | 255..19 | 1185 | 100 | Minus |
CG32736-PB | 240 | CG32736-RB | 1..237 | 255..19 | 1185 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:19:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42308-RB | 640 | CG42308-RB | 165..403 | 257..19 | 1195 | 100 | Minus |
CG42308-RA | 635 | CG42308-RA | 160..398 | 257..19 | 1195 | 100 | Minus |
CG32736-RB | 635 | CG32736-RB | 160..398 | 257..19 | 1195 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:19:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7011601..7011756 | 257..102 | 780 | 100 | Minus |
X | 23542271 | X | 7011818..7011900 | 101..19 | 415 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 08:19:36 has no hits.
BO16055.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:23 Download gff for
BO16055.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-PB | 1..240 | 15..255 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:53:26 Download gff for
BO16055.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42308-RB | 112..355 | 13..257 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:46:46 Download gff for
BO16055.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-RB | 160..403 | 13..257 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:46:46 Download gff for
BO16055.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7011601..7011756 | 102..257 | 100 | -> | Minus |
X | 7011818..7011905 | 13..101 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:53:26 Download gff for
BO16055.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 6905634..6905789 | 102..257 | 100 | -> | Minus |
arm_X | 6905851..6905938 | 13..101 | 97 | | Minus |
BO16055.5prime Sequence
269 bp (269 high quality bases) assembled on 2006-06-16
> BO16055.5prime
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACGCAAGCTTTCTAGACC
BO16055.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32736-PA | 240 | CG32736-RA | 1..237 | 17..253 | 1185 | 100 | Plus |
CG32736-PB | 240 | CG32736-RB | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:35:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42308-RB | 640 | CG42308-RB | 165..403 | 15..253 | 1195 | 100 | Plus |
CG42308-RA | 635 | CG42308-RA | 160..398 | 15..253 | 1195 | 100 | Plus |
CG32736-RB | 635 | CG32736-RB | 160..398 | 15..253 | 1195 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:34:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7011601..7011756 | 15..170 | 780 | 100 | Plus |
X | 23542271 | X | 7011818..7011900 | 171..253 | 415 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-06 12:34:57 has no hits.
BO16055.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:24 Download gff for
BO16055.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-PB | 1..240 | 17..257 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:12:10 Download gff for
BO16055.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42308-RB | 112..355 | 15..259 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:41:11 Download gff for
BO16055.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-RB | 160..403 | 15..259 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:41:11 Download gff for
BO16055.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7011818..7011905 | 171..259 | 97 | | Plus |
X | 7011601..7011756 | 15..170 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:12:10 Download gff for
BO16055.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 6905634..6905789 | 15..170 | 100 | -> | Plus |
arm_X | 6905851..6905938 | 171..259 | 97 | | Plus |
BO16055.complete Sequence
271 bp assembled on 2008-08-15
GenBank Submission: FJ633692
> BO16055.complete
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACGCAAGCTTTCTAGACCAT
BO16055.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:11:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32736-RB | 240 | CG32736-PB | 1..237 | 17..253 | 1185 | 100 | Plus |
CG32736-RA | 240 | CG32736-PA | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:11:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42308-RB | 640 | CG42308-RB | 165..403 | 15..253 | 1195 | 100 | Plus |
CG42308-RA | 635 | CG42308-RA | 160..398 | 15..253 | 1195 | 100 | Plus |
CG32736-RB | 635 | CG32736-RB | 160..398 | 15..253 | 1195 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:11:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7011601..7011756 | 15..170 | 780 | 100 | Plus |
X | 23542271 | X | 7011818..7011900 | 171..253 | 415 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 01:11:43 has no hits.
BO16055.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:48:28 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-RB | 156..399 | 15..259 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:41:51 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42308-RB | 114..350 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:58:14 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-RB | 158..394 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:47:08 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32736-RB | 162..398 | 17..255 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:47:08 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7011603..7011756 | 17..170 | 100 | -> | Plus |
X | 7011818..7011900 | 171..255 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:41:51 Download gff for
BO16055.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 6905636..6905789 | 17..170 | 100 | -> | Plus |
arm_X | 6905851..6905933 | 171..255 | 97 | | Plus |
BO16055.pep Sequence
Translation from 16 to 271
> BO16055.pep
MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN
FYRTFKRRQAKNYVEEQQHLQARAANNTNASFLDH
BO16055.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32736-PB | 79 | CG32736-PB | 1..79 | 1..79 | 421 | 100 | Plus |
CG32736-PA | 79 | CG32736-PA | 1..79 | 1..79 | 421 | 100 | Plus |