Clone BO16055 Report

Search the DGRC for BO16055

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG32736-RA
Protein status:BO16055.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO16055.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16055.3prime
ATGGTCTAGAAAGCTTGCGTTGGTGTTATTCGCGGCTCGCGCCTGCAGAT
GCTGCTGCTCTTCCACGTAGTTCTTCGCCTGGCGGCGCTTAAAAGTGCGG
TAGAAATTGGTCTCGCCCACTGTCCAATTGATCATGGAGAATTCCAGGCC
GGCGCCCAGTAAAAAGAAGAGCGGCAGGAAGCGGTAGACACCGAAGCGCT
TCTTTCCTGGCCAACTGTCCAGCAGACGACGCACGGATCCGCTGTACGGA
CTCATGTCGACTGATAACT

BO16055.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PA 240 CG32736-RA 1..237 255..19 1185 100 Minus
CG32736-PB 240 CG32736-RB 1..237 255..19 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..403 257..19 1195 100 Minus
CG42308-RA 635 CG42308-RA 160..398 257..19 1195 100 Minus
CG32736-RB 635 CG32736-RB 160..398 257..19 1195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 257..102 780 100 Minus
X 23542271 X 7011818..7011900 101..19 415 100 Minus
Blast to na_te.dros performed on 2015-02-11 08:19:36 has no hits.

BO16055.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:23 Download gff for BO16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-PB 1..240 15..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:53:26 Download gff for BO16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 112..355 13..257 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:46:46 Download gff for BO16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 160..403 13..257 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:46:46 Download gff for BO16055.3prime
Subject Subject Range Query Range Percent Splice Strand
X 7011601..7011756 102..257 100 -> Minus
X 7011818..7011905 13..101 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:53:26 Download gff for BO16055.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905634..6905789 102..257 100 -> Minus
arm_X 6905851..6905938 13..101 97   Minus

BO16055.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-06-16

> BO16055.5prime
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACGCAAGCTTTCTAGACC

BO16055.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PA 240 CG32736-RA 1..237 17..253 1185 100 Plus
CG32736-PB 240 CG32736-RB 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..403 15..253 1195 100 Plus
CG42308-RA 635 CG42308-RA 160..398 15..253 1195 100 Plus
CG32736-RB 635 CG32736-RB 160..398 15..253 1195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 15..170 780 100 Plus
X 23542271 X 7011818..7011900 171..253 415 100 Plus
Blast to na_te.dros performed on 2015-02-06 12:34:57 has no hits.

BO16055.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:24 Download gff for BO16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-PB 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:12:10 Download gff for BO16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 112..355 15..259 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:41:11 Download gff for BO16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 160..403 15..259 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:41:11 Download gff for BO16055.5prime
Subject Subject Range Query Range Percent Splice Strand
X 7011818..7011905 171..259 97   Plus
X 7011601..7011756 15..170 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:12:10 Download gff for BO16055.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905634..6905789 15..170 100 -> Plus
arm_X 6905851..6905938 171..259 97   Plus

BO16055.complete Sequence

271 bp assembled on 2008-08-15

GenBank Submission: FJ633692

> BO16055.complete
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACGCAAGCTTTCTAGACCAT

BO16055.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-RB 240 CG32736-PB 1..237 17..253 1185 100 Plus
CG32736-RA 240 CG32736-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..403 15..253 1195 100 Plus
CG42308-RA 635 CG42308-RA 160..398 15..253 1195 100 Plus
CG32736-RB 635 CG32736-RB 160..398 15..253 1195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 15..170 780 100 Plus
X 23542271 X 7011818..7011900 171..253 415 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:11:43 has no hits.

BO16055.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:48:28 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 156..399 15..259 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:41:51 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 114..350 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:58:14 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 158..394 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:47:08 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 162..398 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:47:08 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011603..7011756 17..170 100 -> Plus
X 7011818..7011900 171..255 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:41:51 Download gff for BO16055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905636..6905789 17..170 100 -> Plus
arm_X 6905851..6905933 171..255 97   Plus

BO16055.pep Sequence

Translation from 16 to 271

> BO16055.pep
MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN
FYRTFKRRQAKNYVEEQQHLQARAANNTNASFLDH

BO16055.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PB 79 CG32736-PB 1..79 1..79 421 100 Plus
CG32736-PA 79 CG32736-PA 1..79 1..79 421 100 Plus