Clone BO16056 Report

Search the DGRC for BO16056

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG31360-RA
Protein status:BO16056.pep: Imported from assembly
Sequenced Size:328

Clone Sequence Records

BO16056.3prime Sequence

326 bp (326 high quality bases) assembled on 2006-06-16

> BO16056.3prime
ATGGTCTAGAAAGCTTGCACGTCTAGAAAAGAACTGATGATCAGTGCTAG
TATTTTCCTGTTCTTTTGGCTTCTCGGCGGTTGCCTTCAGGAAATTCGCG
TCTGCCAGGCGGGCCACGCCCAGAACTCCAACGGCTGCAGCCAAGCCTTT
CATAGTGAAATTCTCCAGAGGTTTCGCTTGTCTTTTTTTCGACTGTGCCA
ATAGGAAGGCACCAATTCCCAGGAGTCCAAGGCCACTGACCAGACGGCAG
GCCAAGCAGTCCACCTCGTTGGAAACGTTGTCCTTGTTCCAAAAAGAAAG
TCTACCGATCATGTCGACTGATAACT

BO16056.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-PA 297 CG31360-RA 1..294 312..19 1470 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-RA 649 CG31360-RA 77..370 312..19 1470 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17685173..17685350 312..135 890 100 Minus
3R 32079331 3R 17685411..17685528 136..19 590 100 Minus
Blast to na_te.dros performed on 2015-02-02 14:46:31 has no hits.

BO16056.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:25 Download gff for BO16056.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-PA 1..297 15..312 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:54:48 Download gff for BO16056.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..375 11..312 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:24:30 Download gff for BO16056.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..375 11..312 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:24:30 Download gff for BO16056.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17685173..17685350 135..312 100 -> Minus
3R 17685413..17685533 11..134 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:54:48 Download gff for BO16056.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13510895..13511072 135..312 100 -> Minus
arm_3R 13511135..13511255 11..134 96   Minus

BO16056.5prime Sequence

326 bp (326 high quality bases) assembled on 2006-06-16

> BO16056.5prime
GAAGTTATCAGTCGACATGATCGGTAGACTTTCTTTTTGGAACAAGGACA
ACGTTTCCAACGAGGTGGACTGCTTGGCCTGCCGTCTGGTCAGTGGCCTT
GGACTCCTGGGAATTGGTGCCTTCCTATTGGCACAGTCGAAAAAAAGACA
AGCGAAACCTCTGGAGAATTTCACTATGAAAGGCTTGGCTGCAGCCGTTG
GAGTTCTGGGCGTGGCCCGCCTGGCAGACGCGAATTTCCTGAAGGCAACC
GCCGAGAAGCCAAAAGAACAGGAAAATACTAGCACTGATCATCAGTTCTT
TTCTAGACGTGCAAGCTTTCTAGACC

BO16056.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-PA 297 CG31360-RA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-RA 649 CG31360-RA 77..370 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17685173..17685350 17..194 890 100 Plus
3R 32079331 3R 17685411..17685528 193..310 590 100 Plus
Blast to na_te.dros performed on 2015-02-08 12:03:38 has no hits.

BO16056.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:26 Download gff for BO16056.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-PA 1..297 17..314 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:18:33 Download gff for BO16056.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..375 17..318 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:36:00 Download gff for BO16056.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..375 17..318 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:36:00 Download gff for BO16056.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17685173..17685350 17..194 100 -> Plus
3R 17685413..17685533 195..318 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:18:33 Download gff for BO16056.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13510895..13511072 17..194 100 -> Plus
arm_3R 13511135..13511255 195..318 96   Plus

BO16056.complete Sequence

328 bp assembled on 2008-08-15

GenBank Submission: FJ633693

> BO16056.complete
GAAGTTATCAGTCGACATGATCGGTAGACTTTCTTTTTGGAACAAGGACA
ACGTTTCCAACGAGGTGGACTGCTTGGCCTGCCGTCTGGTCAGTGGCCTT
GGACTCCTGGGAATTGGTGCCTTCCTATTGGCACAGTCGAAAAAAAGACA
AGCGAAACCTCTGGAGAATTTCACTATGAAAGGCTTGGCTGCAGCCGTTG
GAGTTCTGGGCGTGGCCCGCCTGGCAGACGCGAATTTCCTGAAGGCAACC
GCCGAGAAGCCAAAAGAACAGGAAAATACTAGCACTGATCATCAGTTCTT
TTCTAGACGTGCAAGCTTTCTAGACCAT

BO16056.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-RA 297 CG31360-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-RA 649 CG31360-RA 77..370 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17685173..17685350 17..194 890 100 Plus
3R 32079331 3R 17685411..17685528 193..310 590 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:50:49 has no hits.

BO16056.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:35:37 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 72..370 17..318 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:14:44 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..370 17..312 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:00:33 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 72..365 17..312 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:29:30 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
CG31360-RA 77..370 17..312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:29:30 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17685173..17685350 17..194 100 -> Plus
3R 17685413..17685528 195..312 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:14:44 Download gff for BO16056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13510895..13511072 17..194 100 -> Plus
arm_3R 13511135..13511250 195..312 98   Plus

BO16056.pep Sequence

Translation from 16 to 328

> BO16056.pep
MIGRLSFWNKDNVSNEVDCLACRLVSGLGLLGIGAFLLAQSKKRQAKPLE
NFTMKGLAAAVGVLGVARLADANFLKATAEKPKEQENTSTDHQFFSRRAS
FLDH

BO16056.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31360-PA 98 CG31360-PA 1..98 1..98 496 100 Plus