Clone BO16057 Report

Search the DGRC for BO16057

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG17325-RA
Protein status:BO16057.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO16057.3prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16057.3prime
ATGGTCTAGAAAGCTTGCGCAGAAGTGCAGGTTATTGAACTGCTCCCGAT
TGTGGGTGACCATCTGATTGTATTTGAAGGCGGCCGACTGCTGGGAGCTG
CTCTGAGCCGTGAGCCTGGTGTTCCGCAGGAAACTATCCGCCGGACTGCT
CGAAACGGCGTACTTTCCGCCCAGACCCTCCACGGTCCGCATGGGACTCA
GGTGCTTGGCGGGAATGGCCTTGCTGGGTGTGCGAGTTTGGTGAACCATG
TCGACTGATAACT

BO16057.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-PA 234 CG17325-RA 1..231 249..19 1155 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 1018 CG42305-RC 660..890 249..19 1155 100 Minus
CG42305-RB 779 CG42305-RB 299..529 249..19 1155 100 Minus
CG42305-RA 657 CG42305-RA 299..529 249..19 1155 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813461..18813691 249..19 1155 100 Minus
Blast to na_te.dros performed on 2015-01-30 17:58:11 has no hits.

BO16057.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:26 Download gff for BO16057.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17325-PA 1..234 18..249 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:14:35 Download gff for BO16057.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 285..529 19..263 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:34:46 Download gff for BO16057.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 285..529 19..263 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:34:46 Download gff for BO16057.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18813447..18813691 19..263 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:14:35 Download gff for BO16057.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813447..18813691 19..263 97   Minus

BO16057.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16057.5prime
GAAGTTATCAGTCGACATGGTTCACCAAACTCGCACACCCAGCAAGGCCA
TTCCCGCCAAGCACCTGAGTCCCATGCGGACCGTGGAGGGTCTGGGCGGA
AAGTACGCCGTTTCGAGCAGTCCGGCGGATAGTTTCCTGCGGAACACCAG
GCTCACGGCTCAGAGCAGCTCCCAGCAGTCGGCCGCCTTCAAATACAATC
AGATGGTCACCCACAATCGGGAGCAGTTCAATAACCTGCACTTCTGCGCA
AGCTTTCTAGACC

BO16057.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-PA 234 CG17325-RA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 1018 CG42305-RC 660..890 17..247 1155 100 Plus
CG42305-RB 779 CG42305-RB 299..529 17..247 1155 100 Plus
CG42305-RA 657 CG42305-RA 299..529 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813461..18813691 17..247 1155 100 Plus
Blast to na_te.dros performed on 2015-01-30 17:58:22 has no hits.

BO16057.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:27 Download gff for BO16057.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17325-PA 1..234 17..248 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:14:37 Download gff for BO16057.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 284..529 2..247 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:34:48 Download gff for BO16057.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 284..529 2..247 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:34:48 Download gff for BO16057.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18813446..18813691 2..247 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:14:37 Download gff for BO16057.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813446..18813691 2..247 97   Plus

BO16057.complete Sequence

265 bp assembled on 2008-08-15

GenBank Submission: FJ633694

> BO16057.complete
GAAGTTATCAGTCGACATGGTTCACCAAACTCGCACACCCAGCAAGGCCA
TTCCCGCCAAGCACCTGAGTCCCATGCGGACCGTGGAGGGTCTGGGCGGA
AAGTACGCCGTTTCGAGCAGTCCGGCGGATAGTTTCCTGCGGAACACCAG
GCTCACGGCTCAGAGCAGCTCCCAGCAGTCGGCCGCCTTCAAATACAATC
AGATGGTCACCCACAATCGGGAGCAGTTCAATAACCTGCACTTCTGCGCA
AGCTTTCTAGACCAT

BO16057.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-RC 234 CG17325-PC 1..231 17..247 1155 100 Plus
CG17325-RB 234 CG17325-PB 1..231 17..247 1155 100 Plus
CG17325-RA 234 CG17325-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 1018 CG42305-RC 660..890 17..247 1155 100 Plus
CG42305-RB 779 CG42305-RB 299..529 17..247 1155 100 Plus
CG42305-RA 657 CG42305-RA 299..529 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813461..18813691 17..247 1155 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:28:57 has no hits.

BO16057.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:02 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 283..528 2..247 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:03 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 299..529 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:59:31 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 298..528 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:19:22 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 299..529 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:19:22 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813461..18813691 17..249 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:03 Download gff for BO16057.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813461..18813691 17..249 99   Plus

BO16057.pep Sequence

Translation from 16 to 265

> BO16057.pep
MVHQTRTPSKAIPAKHLSPMRTVEGLGGKYAVSSSPADSFLRNTRLTAQS
SSQQSAAFKYNQMVTHNREQFNNLHFCASFLDH

BO16057.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-PC 77 CG17325-PC 1..77 1..77 399 100 Plus
CG17325-PB 77 CG17325-PB 1..77 1..77 399 100 Plus
CG17325-PA 77 CG17325-PA 1..77 1..77 399 100 Plus