Clone BO16058 Report

Search the DGRC for BO16058

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptSec61gamma-RA
Protein status:BO16058.pep: Imported from assembly
Sequenced Size:238

Clone Sequence Records

BO16058.3prime Sequence

236 bp (236 high quality bases) assembled on 2006-06-16

> BO16058.3prime
ATGGTCTAGAAAGCTTGCAGAGCCCACGATGATATTGTTGATGGGGATGT
GTATCAACTTAACGAAGAAGCCGATGAAGCCCATGATGCAGAAGCCCACA
GCAGTGGCGATGGCGATCTTCTGGAACTCCTTGCGGTCGGGCTTGGTGCA
CCGCTTGACCAGGCGGATCGAGTCCTTGGCGAAGGCGCGTCCAGGCTCGG
CAAACTTAACAACCTTGTCCATGTCGACTGATAACT

BO16058.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14214-PA 207 CG14214-RA 1..204 222..19 1020 100 Minus
CG8860-PA 207 CG8860-RA 1..200 222..23 475 89.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..232 225..19 1035 100 Minus
Sec61gamma-RB 792 CG14214-RB 158..364 225..19 1035 100 Minus
Sec61gamma-RA 669 CG14214-RA 158..364 225..19 1035 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644090 225..19 1035 100 Minus
2R 25286936 2R 12179594..12179793 23..222 685 89.5 Plus
Blast to na_te.dros performed on 2015-02-12 18:43:41 has no hits.

BO16058.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:27 Download gff for BO16058.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14214-PA 1..207 15..222 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:22:42 Download gff for BO16058.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..367 15..233 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:14:29 Download gff for BO16058.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..367 15..233 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:14:29 Download gff for BO16058.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19643874..19644093 15..233 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:22:42 Download gff for BO16058.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537907..19538126 15..233 97   Minus

BO16058.5prime Sequence

236 bp (236 high quality bases) assembled on 2006-06-16

> BO16058.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTGCAAGCTTTCTAGACC

BO16058.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14214-PA 207 CG14214-RA 1..204 17..220 1020 100 Plus
CG8860-PA 207 CG8860-RA 1..200 17..216 475 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..232 14..220 1035 100 Plus
Sec61gamma-RB 792 CG14214-RB 158..364 14..220 1035 100 Plus
Sec61gamma-RA 669 CG14214-RA 158..364 14..220 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644090 14..220 1035 100 Plus
2R 25286936 2R 12179594..12179793 216..17 685 89.5 Minus
Blast to na_te.dros performed on 2015-02-11 16:04:57 has no hits.

BO16058.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:29 Download gff for BO16058.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14214-PA 1..207 17..224 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:17:53 Download gff for BO16058.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..367 6..224 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:23:36 Download gff for BO16058.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..367 6..224 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:23:36 Download gff for BO16058.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19643874..19644093 6..224 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:17:53 Download gff for BO16058.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537907..19538126 6..224 97   Plus

BO16058.complete Sequence

238 bp assembled on 2008-08-15

GenBank Submission: FJ633695

> BO16058.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTGCAAGCTTTCTAGACCAT

BO16058.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 207 CG14214-PC 1..204 17..220 1020 100 Plus
Sec61gamma-RB 207 CG14214-PB 1..204 17..220 1020 100 Plus
Sec61gamma-RA 207 CG14214-PA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..232 14..220 1035 100 Plus
Sec61gamma-RB 792 CG14214-RB 158..364 14..220 1035 100 Plus
Sec61gamma-RA 669 CG14214-RA 158..364 14..220 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644090 14..220 1035 100 Plus
2R 25286936 2R 12179594..12179793 216..17 685 89.5 Minus
Blast to na_te.dros performed on 2014-11-27 19:45:46 has no hits.

BO16058.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:25 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 143..362 6..224 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:03:00 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 161..364 17..222 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:17:31 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 156..359 17..222 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:07:50 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 161..364 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:07:50 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
X 19643887..19644090 17..222 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:03:00 Download gff for BO16058.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537920..19538123 17..222 99   Plus

BO16058.pep Sequence

Translation from 16 to 238

> BO16058.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGSASFLDH

BO16058.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 348 100 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 348 100 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 348 100 Plus
CG8860-PA 68 CG8860-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus