Clone Sequence Records
BO16058.3prime Sequence
236 bp (236 high quality bases) assembled on 2006-06-16
> BO16058.3prime
ATGGTCTAGAAAGCTTGCAGAGCCCACGATGATATTGTTGATGGGGATGT
GTATCAACTTAACGAAGAAGCCGATGAAGCCCATGATGCAGAAGCCCACA
GCAGTGGCGATGGCGATCTTCTGGAACTCCTTGCGGTCGGGCTTGGTGCA
CCGCTTGACCAGGCGGATCGAGTCCTTGGCGAAGGCGCGTCCAGGCTCGG
CAAACTTAACAACCTTGTCCATGTCGACTGATAACT
BO16058.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14214-PA | 207 | CG14214-RA | 1..204 | 222..19 | 1020 | 100 | Minus |
CG8860-PA | 207 | CG8860-RA | 1..200 | 222..23 | 475 | 89.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:43:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..232 | 225..19 | 1035 | 100 | Minus |
Sec61gamma-RB | 792 | CG14214-RB | 158..364 | 225..19 | 1035 | 100 | Minus |
Sec61gamma-RA | 669 | CG14214-RA | 158..364 | 225..19 | 1035 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:43:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644090 | 225..19 | 1035 | 100 | Minus |
2R | 25286936 | 2R | 12179594..12179793 | 23..222 | 685 | 89.5 | Plus |
Blast to na_te.dros performed on 2015-02-12 18:43:41 has no hits.
BO16058.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:27 Download gff for
BO16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14214-PA | 1..207 | 15..222 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:22:42 Download gff for
BO16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..367 | 15..233 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:14:29 Download gff for
BO16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..367 | 15..233 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:14:29 Download gff for
BO16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643874..19644093 | 15..233 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:22:42 Download gff for
BO16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537907..19538126 | 15..233 | 97 | | Minus |
BO16058.5prime Sequence
236 bp (236 high quality bases) assembled on 2006-06-16
> BO16058.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTGCAAGCTTTCTAGACC
BO16058.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:29:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14214-PA | 207 | CG14214-RA | 1..204 | 17..220 | 1020 | 100 | Plus |
CG8860-PA | 207 | CG8860-RA | 1..200 | 17..216 | 475 | 89.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:04:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..232 | 14..220 | 1035 | 100 | Plus |
Sec61gamma-RB | 792 | CG14214-RB | 158..364 | 14..220 | 1035 | 100 | Plus |
Sec61gamma-RA | 669 | CG14214-RA | 158..364 | 14..220 | 1035 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:04:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644090 | 14..220 | 1035 | 100 | Plus |
2R | 25286936 | 2R | 12179594..12179793 | 216..17 | 685 | 89.5 | Minus |
Blast to na_te.dros performed on 2015-02-11 16:04:57 has no hits.
BO16058.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:29 Download gff for
BO16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14214-PA | 1..207 | 17..224 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:17:53 Download gff for
BO16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..367 | 6..224 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:23:36 Download gff for
BO16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..367 | 6..224 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:23:36 Download gff for
BO16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643874..19644093 | 6..224 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:17:53 Download gff for
BO16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537907..19538126 | 6..224 | 97 | | Plus |
BO16058.complete Sequence
238 bp assembled on 2008-08-15
GenBank Submission: FJ633695
> BO16058.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTGCAAGCTTTCTAGACCAT
BO16058.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:45:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 207 | CG14214-PC | 1..204 | 17..220 | 1020 | 100 | Plus |
Sec61gamma-RB | 207 | CG14214-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
Sec61gamma-RA | 207 | CG14214-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:45:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..232 | 14..220 | 1035 | 100 | Plus |
Sec61gamma-RB | 792 | CG14214-RB | 158..364 | 14..220 | 1035 | 100 | Plus |
Sec61gamma-RA | 669 | CG14214-RA | 158..364 | 14..220 | 1035 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:45:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644090 | 14..220 | 1035 | 100 | Plus |
2R | 25286936 | 2R | 12179594..12179793 | 216..17 | 685 | 89.5 | Minus |
Blast to na_te.dros performed on 2014-11-27 19:45:46 has no hits.
BO16058.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:25 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 143..362 | 6..224 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:03:00 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 161..364 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:17:31 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 156..359 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:07:50 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 161..364 | 17..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:07:50 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643887..19644090 | 17..222 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:03:00 Download gff for
BO16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537920..19538123 | 17..222 | 99 | | Plus |
BO16058.pep Sequence
Translation from 16 to 238
> BO16058.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGSASFLDH
BO16058.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 348 | 100 | Plus |
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |