Clone BO16062 Report

Search the DGRC for BO16062

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG14812-RA
Protein status:BO16062.pep: Imported from assembly
Sequenced Size:334

Clone Sequence Records

BO16062.5prime Sequence

332 bp (332 high quality bases) assembled on 2006-06-16

> BO16062.5prime
GAAGTTATCAGTCGACATGGAGCAGCAACTGGAGAAAGTCCTAGCGGAAA
TCGCCGCACGGCAGGACACAGTGGGAGCTCTGCTGGCCAATCGCCAGGGA
TTGTGTTTGGGCACCAAAGGAGACATTGATCCGAACGTGTCCGGCATCGG
AATGGCCATTTCCGAGCAGGTGGCCAAACTGGAGCTGAATGCCACGGCTC
CTGCAACGATTTGCCTTTACAGCGGAAACAAACGCTGTGTCATCCAGAAG
GACGGCGAGATCACAGGCGTTATCTTCAAGCAGCCGACGGGTACATCGGC
GACCGCCCCCAGCAACGCAAGCTTTCTAGACC

BO16062.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PA 303 CG14812-RA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..369 16..316 1505 100 Plus
CG14812-RA 720 CG14812-RA 69..369 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 231..114 590 100 Minus
X 23542271 X 1858322..1858406 316..232 425 100 Minus
X 23542271 X 1858736..1858797 113..52 310 100 Minus
X 23542271 X 1858868..1858903 51..16 180 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:22:52 has no hits.

BO16062.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:33 Download gff for BO16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-PA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 17:00:25 Download gff for BO16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 89..397 8..320 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:02:53 Download gff for BO16062.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 64..372 8..320 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:02:53 Download gff for BO16062.5prime
Subject Subject Range Query Range Percent Splice Strand
X 1858319..1858406 232..320 97 <- Minus
X 1858561..1858678 114..231 100 <- Minus
X 1858736..1858797 52..113 100 <- Minus
X 1858868..1858908 8..51 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 17:00:25 Download gff for BO16062.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752769..1752830 52..113 100 <- Minus
arm_X 1752901..1752941 8..51 93   Minus
arm_X 1752352..1752439 232..320 97 <- Minus
arm_X 1752594..1752711 114..231 100 <- Minus

BO16062.3prime Sequence

332 bp (332 high quality bases) assembled on 2006-06-16

> BO16062.3prime
ATGGTCTAGAAAGCTTGCGTTGCTGGGGGCGGTCGCCGATGTACCCGTCG
GCTGCTTGAAGATAACGCCTGTGATCTCGCCGTCCTTCTGGATGACACAG
CGTTTGTTTCCGCTGTAAAGGCAAATCGTTGCAGGAGCCGTGGCATTCAG
CTCCAGTTTGGCCACCTGCTCGGAAATGGCCATTCCGATGCCGGACACGT
TCGGATCAATGTCTCCTTTGGTGCCCAAACACAATCCCTGGCGATTGGCC
AGCAGAGCTCCCACTGTGTCCTGCCGTGCGGCGATTTCCGCTAGGACTTT
CTCCAGTTGCTGCTCCATGTCGACTGATAACT

BO16062.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PA 303 CG14812-RA 1..300 318..19 1500 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..369 319..19 1505 100 Minus
CG14812-RA 720 CG14812-RA 69..369 319..19 1505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 104..221 590 100 Plus
X 23542271 X 1858322..1858406 19..103 425 100 Plus
X 23542271 X 1858736..1858797 222..283 310 100 Plus
X 23542271 X 1858868..1858903 284..319 180 100 Plus
Blast to na_te.dros performed on 2015-02-11 16:05:37 has no hits.

BO16062.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:32 Download gff for BO16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:18:06 Download gff for BO16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 89..397 15..327 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:24:46 Download gff for BO16062.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 64..372 15..327 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:24:46 Download gff for BO16062.3prime
Subject Subject Range Query Range Percent Splice Strand
X 1858319..1858406 15..103 97 <- Plus
X 1858561..1858678 104..221 100 <- Plus
X 1858736..1858797 222..283 100 <- Plus
X 1858868..1858908 284..327 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:18:06 Download gff for BO16062.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752352..1752439 15..103 97 <- Plus
arm_X 1752594..1752711 104..221 100 <- Plus
arm_X 1752769..1752830 222..283 100 <- Plus
arm_X 1752901..1752941 284..327 93   Plus

BO16062.complete Sequence

334 bp assembled on 2008-08-15

GenBank Submission: FJ633697

> BO16062.complete
GAAGTTATCAGTCGACATGGAGCAGCAACTGGAGAAAGTCCTAGCGGAAA
TCGCCGCACGGCAGGACACAGTGGGAGCTCTGCTGGCCAATCGCCAGGGA
TTGTGTTTGGGCACCAAAGGAGACATTGATCCGAACGTGTCCGGCATCGG
AATGGCCATTTCCGAGCAGGTGGCCAAACTGGAGCTGAATGCCACGGCTC
CTGCAACGATTTGCCTTTACAGCGGAAACAAACGCTGTGTCATCCAGAAG
GACGGCGAGATCACAGGCGTTATCTTCAAGCAGCCGACGGGTACATCGGC
GACCGCCCCCAGCAACGCAAGCTTTCTAGACCAT

BO16062.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 303 CG14812-PB 1..300 17..316 1500 100 Plus
CG14812-RA 303 CG14812-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-RB 802 CG14812-RB 69..369 16..316 1505 100 Plus
CG14812-RA 720 CG14812-RA 69..369 16..316 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1858561..1858678 231..114 590 100 Minus
X 23542271 X 1858322..1858406 316..232 425 100 Minus
X 23542271 X 1858736..1858797 113..52 310 100 Minus
X 23542271 X 1858868..1858903 51..16 180 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:06:53 has no hits.

BO16062.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:12 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 44..352 8..320 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:39:19 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 95..394 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:25:52 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 50..349 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:44:46 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
CG14812-RA 70..369 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:44:46 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
X 1858320..1858406 232..318 97 <- Minus
X 1858561..1858678 114..231 100 <- Minus
X 1858736..1858797 52..113 100 <- Minus
X 1858868..1858902 17..51 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:39:19 Download gff for BO16062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1752769..1752830 52..113 100 <- Minus
arm_X 1752901..1752935 17..51 100   Minus
arm_X 1752353..1752439 232..318 97 <- Minus
arm_X 1752594..1752711 114..231 100 <- Minus

BO16062.pep Sequence

Translation from 16 to 334

> BO16062.pep
MEQQLEKVLAEIAARQDTVGALLANRQGLCLGTKGDIDPNVSGIGMAISE
QVAKLELNATAPATICLYSGNKRCVIQKDGEITGVIFKQPTGTSATAPSN
ASFLDH

BO16062.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14812-PB 100 CG14812-PB 1..100 1..100 502 100 Plus
CG14812-PA 100 CG14812-PA 1..100 1..100 502 100 Plus