Clone BO16063 Report

Search the DGRC for BO16063

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:63
Vector:pDNR-Dual
Associated Gene/Transcriptmex1-RA
Protein status:BO16063.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO16063.5prime Sequence

281 bp (281 high quality bases) assembled on 2006-06-16

> BO16063.5prime
GAAGTTATCAGTCGACATGTGCAACGCTCTCTGTGAATGCCTCAAATGTC
CCGGCAAAGTGGTTTGCTGCTGCTGTTCCTGCGCCTGCAAGATGCTCCTG
AGCATCGTGTTTTCTGCGCTCCTGATGGTCGTGGTGATCGGCTTGATTGT
CTACTTCACGGTCTTCTATCACAAGGATAAGAACACGGATGAGGTGCAGA
AGCAGGTCGCCCAACTGACGCCCATTGTGAAGCGCAGCATACGCGACTAC
TTCAACAAGGAGTACGCAAGCTTTCTAGACC

BO16063.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7936-PA 252 mex1-RA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..674 16..265 1250 100 Plus
mex1-RA 710 CG7936-RA 101..350 16..265 1250 100 Plus
mex1-RB 741 CG7936-RB 83..332 16..265 1145 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517833..15518034 265..64 995 99.5 Minus
3L 28110227 3L 15518308..15518361 69..16 270 100 Minus
Blast to na_te.dros performed 2015-02-08 12:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 138..64 111 62.7 Minus

BO16063.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:34 Download gff for BO16063.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7936-PA 1..252 17..268 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:18:57 Download gff for BO16063.5prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 91..356 2..272 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:36:22 Download gff for BO16063.5prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 91..356 2..272 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 12:36:22 Download gff for BO16063.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 15517827..15518028 70..272 98 <- Minus
3L 15518308..15518361 16..69 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:18:57 Download gff for BO16063.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510927..15511128 70..272 98 <- Minus
arm_3L 15511408..15511461 16..69 100 -> Minus

BO16063.3prime Sequence

281 bp (281 high quality bases) assembled on 2006-06-16

> BO16063.3prime
ATGGTCTAGAAAGCTTGCGTACTCCTTGTTGAAGTAGTCGCGTATGCTGC
GCTTCACAATGGGCGTCAGTTGGGCGACCTGCTTCTGCACCTCATCCGTG
TTCTTATCCTTGTGATAGAAGACCGTGAAGTAGACAATCAAGCCGATCAC
CACGACCATCAGGAGCGCAGAAAACACGATGCTCAGGAGCATCTTGCAGG
CGCAGGAACAGCAGCAGCAAACCACTTTGCCGGGACATTTGAGGCATTCA
CAGAGAGCGTTGCACATGTCGACTGATAACT

BO16063.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7936-PA 252 mex1-RA 1..249 267..19 1245 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 14:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..674 268..19 1250 100 Minus
mex1-RA 710 CG7936-RA 101..350 268..19 1250 100 Minus
mex1-RB 741 CG7936-RB 83..332 268..19 1145 97.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 14:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517833..15518034 19..220 995 99.5 Plus
3L 28110227 3L 15518308..15518361 215..268 270 100 Plus
Blast to na_te.dros performed 2015-02-02 14:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 146..220 111 62.7 Plus

BO16063.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:34 Download gff for BO16063.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7936-PA 1..252 16..267 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 14:55:05 Download gff for BO16063.3prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 92..356 12..281 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 15:24:43 Download gff for BO16063.3prime
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 92..356 12..281 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 15:24:43 Download gff for BO16063.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 15517827..15518028 12..214 98 <- Plus
3L 15518308..15518370 215..281 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 14:55:05 Download gff for BO16063.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510927..15511128 12..214 98 <- Plus
arm_3L 15511408..15511470 215..281 92   Plus

BO16063.complete Sequence

283 bp assembled on 2008-08-15

GenBank Submission: FJ633698

> BO16063.complete
GAAGTTATCAGTCGACATGTGCAACGCTCTCTGTGAATGCCTCAAATGTC
CCGGCAAAGTGGTTTGCTGCTGCTGTTCCTGCGCCTGCAAGATGCTCCTG
AGCATCGTGTTTTCTGCGCTCCTGATGGTCGTGGTGATCGGCTTGATTGT
CTACTTCACGGTCTTCTATCACAAGGATAAGAACACGGATGAGGTGCAGA
AGCAGGTCGCCCAACTGACGCCCATTGTGAAGCGCAGCATACGCGACTAC
TTCAACAAGGAGTACGCAAGCTTTCTAGACCAT

BO16063.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 252 CG7936-PC 1..249 17..265 1245 100 Plus
mex1-RA 252 CG7936-PA 1..249 17..265 1245 100 Plus
mex1-RB 252 CG7936-PB 1..249 17..265 1140 97.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RC 1034 CG7936-RC 425..674 16..265 1250 100 Plus
mex1-RA 710 CG7936-RA 101..350 16..265 1250 100 Plus
mex1-RB 741 CG7936-RB 83..332 16..265 1145 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517833..15518034 265..64 995 99.5 Minus
3L 28110227 3L 15518308..15518361 69..16 270 100 Minus
Blast to na_te.dros performed 2014-11-27 23:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6820 138..64 111 62.7 Minus

BO16063.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:12 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 86..351 2..272 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:42:34 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 102..350 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:57:57 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 97..345 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:11:50 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 102..350 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:11:50 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15517830..15518028 70..267 98 <- Minus
3L 15518308..15518360 17..69 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:42:34 Download gff for BO16063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15510930..15511128 70..267 98 <- Minus
arm_3L 15511408..15511460 17..69 100   Minus

BO16063.pep Sequence

Translation from 16 to 283

> BO16063.pep
MCNALCECLKCPGKVVCCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEYASFLDH

BO16063.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PC 83 CG7936-PC 1..83 1..83 450 100 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 450 100 Plus
mex1-PB 83 CG7936-PB 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 149 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 149 36.4 Plus