Clone BO16065 Report

Search the DGRC for BO16065

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG18081-RA
Protein status:BO16065.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO16065.3prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16065.3prime
ATGGTCTAGAAAGCTTGCGACCTCCTTCAGCTCATCGGGCATGTCATTCT
TGGGATGCTTGTTCTCGAAATGCTGCTTGTAAGTCTTCGGATCGGGCATT
TGCGACTTGCAAACGGCGCACACATAGACAAGTGCCTTCTGGGCCGCCTT
CTTCTGGTCGTTGGCACTGTGTCCTTGTTGCTTCTTTAGTTTGGCCTGCT
TCTCGGAGGCCTTCGCCTGCGACTGGATCTTCTGGTGTCCACGTGCCATG
TCGACTGATAACT

BO16065.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PA 234 CG18081-RA 1..231 249..19 1155 100 Minus
CG15715-PA 234 CG15715-RA 1..231 249..19 930 96.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 04:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..428 249..19 1155 100 Minus
CG18081-RB 886 CG18081-RB 86..316 249..19 1155 100 Minus
CG18081-RA 721 CG18081-RA 202..432 249..19 1155 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 04:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 106..249 720 100 Plus
3L 28110227 3L 15836780..15836923 106..249 705 99.3 Plus
3L 28110227 3L 15834365..15834453 19..107 445 100 Plus
3L 28110227 3L 15836162..15836250 19..107 325 91 Plus
Blast to na_te.dros performed 2015-02-03 04:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 174..129 104 69.6 Minus

BO16065.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:37 Download gff for BO16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-PA 1..234 16..249 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:12:42 Download gff for BO16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..432 19..257 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:25:41 Download gff for BO16065.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..432 19..257 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:25:41 Download gff for BO16065.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 15834365..15834451 19..105 100 <- Plus
3L 15834734..15834883 106..257 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:12:42 Download gff for BO16065.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827465..15827551 19..105 100 <- Plus
arm_3L 15827834..15827983 106..257 97   Plus

BO16065.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16065.5prime
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCGCA
AGCTTTCTAGACC

BO16065.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PA 234 CG18081-RA 1..231 17..247 1155 100 Plus
CG15715-PA 234 CG15715-RA 1..231 17..247 930 96.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..428 17..247 1155 100 Plus
CG18081-RB 886 CG18081-RB 86..316 17..247 1155 100 Plus
CG18081-RA 721 CG18081-RA 202..432 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 160..17 720 100 Minus
3L 28110227 3L 15836780..15836923 160..17 705 99.3 Minus
3L 28110227 3L 15834365..15834453 247..159 445 100 Minus
3L 28110227 3L 15836162..15836250 247..159 325 91 Minus
Blast to na_te.dros performed 2015-02-06 12:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 92..137 104 69.6 Plus

BO16065.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:37 Download gff for BO16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-PA 1..234 17..250 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 04:12:55 Download gff for BO16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..432 9..247 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:41:54 Download gff for BO16065.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 196..432 9..247 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:41:54 Download gff for BO16065.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 15834365..15834451 161..247 100 <- Minus
3L 15834734..15834883 9..160 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 04:12:55 Download gff for BO16065.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827465..15827551 161..247 100 <- Minus
arm_3L 15827834..15827983 9..160 97   Minus

BO16065.complete Sequence

265 bp assembled on 2008-08-15

GenBank Submission: FJ633700

> BO16065.complete
GAAGTTATCAGTCGACATGGCACGTGGACACCAGAAGATCCAGTCGCAGG
CGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAAGGACACAGT
GCCAACGACCAGAAGAAGGCGGCCCAGAAGGCACTTGTCTATGTGTGCGC
CGTTTGCAAGTCGCAAATGCCCGATCCGAAGACTTACAAGCAGCATTTCG
AGAACAAGCATCCCAAGAATGACATGCCCGATGAGCTGAAGGAGGTCGCA
AGCTTTCTAGACCAT

BO16065.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 234 CG18081-PC 1..231 17..247 1155 100 Plus
CG18081-RB 234 CG18081-PB 1..231 17..247 1155 100 Plus
CG18081-RA 234 CG18081-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-RC 717 CG18081-RC 198..428 17..247 1155 100 Plus
CG18081-RB 886 CG18081-RB 86..316 17..247 1155 100 Plus
CG18081-RA 721 CG18081-RA 202..432 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15834734..15834877 160..17 720 100 Minus
3L 28110227 3L 15836780..15836923 160..17 705 99.3 Minus
3L 28110227 3L 15834365..15834453 247..159 445 100 Minus
3L 28110227 3L 15836162..15836250 247..159 325 91 Minus
Blast to na_te.dros performed 2014-11-27 15:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 1443..1488 92..137 104 69.6 Plus

BO16065.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:46:46 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 194..430 9..247 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:49:57 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 202..432 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 10:59:03 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 200..430 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:28 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
CG18081-RA 202..432 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:28 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15834362..15834451 161..249 97 <- Minus
3L 15834734..15834877 17..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:49:57 Download gff for BO16065.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15827462..15827551 161..249 97 <- Minus
arm_3L 15827834..15827977 17..160 100   Minus

BO16065.pep Sequence

Translation from 16 to 265

> BO16065.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDMPDELKEVASFLDH

BO16065.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18081-PC 77 CG18081-PC 1..77 1..77 406 100 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 406 100 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 406 100 Plus
CG15715-PB 77 CG15715-PB 1..77 1..77 398 97.4 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 398 97.4 Plus