Clone BO16067 Report

Search the DGRC for BO16067

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG17734-RA
Protein status:BO16067.pep: Imported from assembly
Sequenced Size:337

Clone Sequence Records

BO16067.5prime Sequence

335 bp (335 high quality bases) assembled on 2006-06-16

> BO16067.5prime
GAAGTTATCAGTCGACATGAGTTCCAAGTCCCTTTTCGACAGCGAGGAGG
ATGCCGCTCAGGCCAACAAATTATCCAGGAAAGCAAAGGAATCGCCCTTC
ATGCTTGTGGGTATTACCGGATTCGTGGCCGCCGGATTGATTGGAGCGTA
CAAGTACCGGAACCGCGGAACGATGAGCACCAGCGTCTTCCTGATGCAGC
TGCGAGTCGCCGCCCAGGGAACCGTCGTCGGATGTCTGACCCTCGGACTG
GCCTACAGCATGGCCAAGGAGTACCTGTTCGACAAGGCGCCCAAGGAAAA
CACAAAGTCATTGACTAACGCAAGCTTTCTAGACC

BO16067.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-PA 306 CG17734-RA 1..303 17..319 1515 100 Plus
CG17734-PB 288 CG17734-RB 1..284 17..300 1420 100 Plus
CG11825-PA 303 CG11825-RA 157..219 173..235 165 90.4 Plus
CG11825-PA 303 CG11825-RA 79..149 95..165 155 88.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-RA 764 CG17734-RA 125..427 17..319 1515 100 Plus
CG17734-RB 1024 CG17734-RB 125..408 17..300 1420 100 Plus
CG17734-RC 1317 CG17734-RC 511..701 110..300 955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 23:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11242824..11243014 300..110 955 100 Minus
2R 25286936 2R 10420733..10421003 287..17 695 83.8 Minus
3R 32079331 3R 11243780..11243875 112..17 480 100 Minus
Blast to na_te.dros performed on 2015-02-10 23:01:45 has no hits.

BO16067.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:40 Download gff for BO16067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-PA 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:14:53 Download gff for BO16067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 117..432 8..324 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:15:59 Download gff for BO16067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 117..432 8..324 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:15:59 Download gff for BO16067.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11242540..11242563 301..324 91 <- Minus
3R 11242824..11243013 111..300 100 <- Minus
3R 11243782..11243883 8..110 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:14:53 Download gff for BO16067.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7068262..7068285 301..324 91 <- Minus
arm_3R 7068546..7068735 111..300 100 <- Minus
arm_3R 7069504..7069605 8..110 96   Minus

BO16067.3prime Sequence

335 bp (335 high quality bases) assembled on 2006-06-16

> BO16067.3prime
ATGGTCTAGAAAGCTTGCGTTAGTCAATGACTTTGTGTTTTCCTTGGGCG
CCTTGTCGAACAGGTACTCCTTGGCCATGCTGTAGGCCAGTCCGAGGGTC
AGACATCCGACGACGGTTCCCTGGGCGGCGACTCGCAGCTGCATCAGGAA
GACGCTGGTGCTCATCGTTCCGCGGTTCCGGTACTTGTACGCTCCAATCA
ATCCGGCGGCCACGAATCCGGTAATACCCACAAGCATGAAGGGCGATTCC
TTTGCTTTCCTGGATAATTTGTTGGCCTGAGCGGCATCCTCCTCGCTGTC
GAAAAGGGACTTGGAACTCATGTCGACTGATAACT

BO16067.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-PA 306 CG17734-RA 1..303 321..19 1515 100 Minus
CG17734-PB 288 CG17734-RB 1..284 321..38 1420 100 Minus
CG11825-PA 303 CG11825-RA 157..219 165..103 165 90.4 Minus
CG11825-PA 303 CG11825-RA 79..149 243..173 155 88.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 06:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-RA 764 CG17734-RA 125..427 321..19 1515 100 Minus
CG17734-RB 1024 CG17734-RB 125..408 321..38 1420 100 Minus
CG17734-RC 1317 CG17734-RC 511..701 228..38 955 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 06:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11242824..11243014 38..228 955 100 Plus
2R 25286936 2R 10420733..10421003 51..321 695 83.8 Plus
3R 32079331 3R 11243780..11243875 226..321 480 100 Plus
Blast to na_te.dros performed on 2015-01-31 06:37:59 has no hits.

BO16067.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:40 Download gff for BO16067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-PA 1..306 15..321 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 22:11:46 Download gff for BO16067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 117..432 14..330 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 07:43:22 Download gff for BO16067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 117..432 14..330 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 07:43:22 Download gff for BO16067.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11242540..11242563 14..37 91 <- Plus
3R 11242824..11243013 38..227 100 <- Plus
3R 11243782..11243883 228..330 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 22:11:46 Download gff for BO16067.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7069504..7069605 228..330 96   Plus
arm_3R 7068546..7068735 38..227 100 <- Plus
arm_3R 7068262..7068285 14..37 91 <- Plus

BO16067.complete Sequence

337 bp assembled on 2008-08-15

GenBank Submission: FJ633702

> BO16067.complete
GAAGTTATCAGTCGACATGAGTTCCAAGTCCCTTTTCGACAGCGAGGAGG
ATGCCGCTCAGGCCAACAAATTATCCAGGAAAGCAAAGGAATCGCCCTTC
ATGCTTGTGGGTATTACCGGATTCGTGGCCGCCGGATTGATTGGAGCGTA
CAAGTACCGGAACCGCGGAACGATGAGCACCAGCGTCTTCCTGATGCAGC
TGCGAGTCGCCGCCCAGGGAACCGTCGTCGGATGTCTGACCCTCGGACTG
GCCTACAGCATGGCCAAGGAGTACCTGTTCGACAAGGCGCCCAAGGAAAA
CACAAAGTCATTGACTAACGCAAGCTTTCTAGACCAT

BO16067.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-RA 306 CG17734-PA 1..303 17..319 1515 100 Plus
CG17734-RB 288 CG17734-PB 1..284 17..300 1420 100 Plus
CG11825-RC 411 CG11825-PC 109..379 17..287 695 83.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-RA 764 CG17734-RA 125..427 17..319 1515 100 Plus
CG17734-RB 1024 CG17734-RB 125..408 17..300 1420 100 Plus
CG17734-RC 1317 CG17734-RC 511..701 110..300 955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11242824..11243014 300..110 955 100 Minus
2R 25286936 2R 10420733..10421003 287..17 695 83.8 Minus
3R 32079331 3R 11243780..11243875 112..17 480 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:35:33 has no hits.

BO16067.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:40 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 94..409 8..324 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:27 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 125..427 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:55:18 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 102..404 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:51:24 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
CG17734-RA 125..427 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:51:24 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11242824..11243013 111..300 100 <- Minus
3R 11243782..11243875 17..110 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:27 Download gff for BO16067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7068546..7068735 111..300 100 <- Minus
arm_3R 7069504..7069597 17..110 100   Minus

BO16067.pep Sequence

Translation from 16 to 337

> BO16067.pep
MSSKSLFDSEEDAAQANKLSRKAKESPFMLVGITGFVAAGLIGAYKYRNR
GTMSTSVFLMQLRVAAQGTVVGCLTLGLAYSMAKEYLFDKAPKENTKSLT
NASFLDH

BO16067.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17734-PA 101 CG17734-PA 1..101 1..101 500 100 Plus
CG17734-PB 95 CG17734-PB 1..94 1..94 465 100 Plus
CG11825-PA 100 CG11825-PA 1..97 1..97 411 83.5 Plus
CG11825-PC 136 CG11825-PC 37..133 1..97 411 83.5 Plus
CG11825-PD 72 CG11825-PD 1..69 29..97 299 85.5 Plus