Clone BO16075 Report

Search the DGRC for BO16075

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:160
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG32276-RA
Protein status:BO16075.pep: Imported from assembly
Sequenced Size:226

Clone Sequence Records

BO16075.5prime Sequence

224 bp (224 high quality bases) assembled on 2006-06-16

> BO16075.5prime
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGGCAAGCTTTCTAGACC

BO16075.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PA 195 CG32276-RA 1..192 17..208 960 100 Plus
CG32276-PB 195 CG32276-RB 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..278 17..208 960 100 Plus
CG32276-RA 865 CG32276-RA 213..404 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198324..3198432 208..100 545 100 Minus
3L 28110227 3L 3198752..3198835 100..17 420 100 Minus
Blast to na_te.dros performed on 2015-02-10 18:38:53 has no hits.

BO16075.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:51 Download gff for BO16075.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-PB 1..195 17..212 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:50:49 Download gff for BO16075.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..408 10..213 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:54:42 Download gff for BO16075.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..408 10..213 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 20:54:42 Download gff for BO16075.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3198752..3198840 10..100 95   Minus
3L 3198320..3198431 101..213 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:50:49 Download gff for BO16075.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198320..3198431 101..213 98 <- Minus
arm_3L 3198752..3198840 10..100 95   Minus

BO16075.3prime Sequence

224 bp (224 high quality bases) assembled on 2006-06-16

> BO16075.3prime
ATGGTCTAGAAAGCTTGCCGCGGCGCGTATCGACTGAACAATCTGGAAAA
TGGCAGAGCCGCAGACCACAAAGATGAACAGCGCCAGGAGCCAGGGACCC
ACCGGATATTGACCCTCTTTCGTTTTCGAGGATTTGGGTACATTGCCACG
CATTGTCACATATTTGCTGGCCTTCTCGTTAGCGACGCGCATTCTCTGTG
GTGGAGCCATGTCGACTGATAACT

BO16075.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PA 195 CG32276-RA 1..192 210..19 960 100 Minus
CG32276-PB 195 CG32276-RB 1..192 210..19 960 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..278 210..19 960 100 Minus
CG32276-RA 865 CG32276-RA 213..404 210..19 960 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198324..3198432 19..127 545 100 Plus
3L 28110227 3L 3198752..3198835 127..210 420 100 Plus
Blast to na_te.dros performed on 2015-02-11 16:06:47 has no hits.

BO16075.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:50 Download gff for BO16075.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-PB 1..195 15..210 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:18:24 Download gff for BO16075.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..408 14..217 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:26:47 Download gff for BO16075.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 208..408 14..217 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:26:47 Download gff for BO16075.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3198320..3198431 14..126 98 <- Plus
3L 3198752..3198840 127..217 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:18:24 Download gff for BO16075.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198320..3198431 14..126 98 <- Plus
arm_3L 3198752..3198840 127..217 95   Plus

BO16075.complete Sequence

226 bp assembled on 2008-08-15

GenBank Submission: FJ633706

> BO16075.complete
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGGCAAGCTTTCTAGACCAT

BO16075.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 195 CG32276-PB 1..192 17..208 960 100 Plus
CG32276-RA 195 CG32276-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-RB 739 CG32276-RB 87..278 17..208 960 100 Plus
CG32276-RA 865 CG32276-RA 213..404 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3198324..3198432 208..100 545 100 Minus
3L 28110227 3L 3198752..3198835 100..17 420 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:46:23 has no hits.

BO16075.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:36:09 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 204..404 10..213 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:37:32 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 213..404 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:09:38 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 209..400 17..210 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:52 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
CG32276-RA 213..404 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:52 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3198322..3198431 101..210 98 <- Minus
3L 3198752..3198835 17..100 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:37:32 Download gff for BO16075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3198322..3198431 101..210 98 <- Minus
arm_3L 3198752..3198835 17..100 100   Minus

BO16075.pep Sequence

Translation from 16 to 226

> BO16075.pep
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVC
GSAIFQIVQSIRAAASFLDH

BO16075.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32276-PB 64 CG32276-PB 1..64 1..64 327 100 Plus
CG32276-PA 64 CG32276-PA 1..64 1..64 327 100 Plus