Clone Sequence Records
BO16075.5prime Sequence
224 bp (224 high quality bases) assembled on 2006-06-16
> BO16075.5prime
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGGCAAGCTTTCTAGACC
BO16075.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:33:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PA | 195 | CG32276-RA | 1..192 | 17..208 | 960 | 100 | Plus |
CG32276-PB | 195 | CG32276-RB | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:38:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..278 | 17..208 | 960 | 100 | Plus |
CG32276-RA | 865 | CG32276-RA | 213..404 | 17..208 | 960 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:38:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198324..3198432 | 208..100 | 545 | 100 | Minus |
3L | 28110227 | 3L | 3198752..3198835 | 100..17 | 420 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 18:38:53 has no hits.
BO16075.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:51 Download gff for
BO16075.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-PB | 1..195 | 17..212 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:50:49 Download gff for
BO16075.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..408 | 10..213 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:54:42 Download gff for
BO16075.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..408 | 10..213 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 20:54:42 Download gff for
BO16075.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198752..3198840 | 10..100 | 95 | | Minus |
3L | 3198320..3198431 | 101..213 | 98 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:50:49 Download gff for
BO16075.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198320..3198431 | 101..213 | 98 | <- | Minus |
arm_3L | 3198752..3198840 | 10..100 | 95 | | Minus |
BO16075.3prime Sequence
224 bp (224 high quality bases) assembled on 2006-06-16
> BO16075.3prime
ATGGTCTAGAAAGCTTGCCGCGGCGCGTATCGACTGAACAATCTGGAAAA
TGGCAGAGCCGCAGACCACAAAGATGAACAGCGCCAGGAGCCAGGGACCC
ACCGGATATTGACCCTCTTTCGTTTTCGAGGATTTGGGTACATTGCCACG
CATTGTCACATATTTGCTGGCCTTCTCGTTAGCGACGCGCATTCTCTGTG
GTGGAGCCATGTCGACTGATAACT
BO16075.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:33:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PA | 195 | CG32276-RA | 1..192 | 210..19 | 960 | 100 | Minus |
CG32276-PB | 195 | CG32276-RB | 1..192 | 210..19 | 960 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:06:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..278 | 210..19 | 960 | 100 | Minus |
CG32276-RA | 865 | CG32276-RA | 213..404 | 210..19 | 960 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:06:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198324..3198432 | 19..127 | 545 | 100 | Plus |
3L | 28110227 | 3L | 3198752..3198835 | 127..210 | 420 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 16:06:47 has no hits.
BO16075.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:44:50 Download gff for
BO16075.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-PB | 1..195 | 15..210 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:18:24 Download gff for
BO16075.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..408 | 14..217 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:26:47 Download gff for
BO16075.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 208..408 | 14..217 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:26:47 Download gff for
BO16075.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198320..3198431 | 14..126 | 98 | <- | Plus |
3L | 3198752..3198840 | 127..217 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:18:24 Download gff for
BO16075.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198320..3198431 | 14..126 | 98 | <- | Plus |
arm_3L | 3198752..3198840 | 127..217 | 95 | | Plus |
BO16075.complete Sequence
226 bp assembled on 2008-08-15
GenBank Submission: FJ633706
> BO16075.complete
GAAGTTATCAGTCGACATGGCTCCACCACAGAGAATGCGCGTCGCTAACG
AGAAGGCCAGCAAATATGTGACAATGCGTGGCAATGTACCCAAATCCTCG
AAAACGAAAGAGGGTCAATATCCGGTGGGTCCCTGGCTCCTGGCGCTGTT
CATCTTTGTGGTCTGCGGCTCTGCCATTTTCCAGATTGTTCAGTCGATAC
GCGCCGCGGCAAGCTTTCTAGACCAT
BO16075.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:46:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 195 | CG32276-PB | 1..192 | 17..208 | 960 | 100 | Plus |
CG32276-RA | 195 | CG32276-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:46:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-RB | 739 | CG32276-RB | 87..278 | 17..208 | 960 | 100 | Plus |
CG32276-RA | 865 | CG32276-RA | 213..404 | 17..208 | 960 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:46:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3198324..3198432 | 208..100 | 545 | 100 | Minus |
3L | 28110227 | 3L | 3198752..3198835 | 100..17 | 420 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 23:46:23 has no hits.
BO16075.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:36:09 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 204..404 | 10..213 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:37:32 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 213..404 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:09:38 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 209..400 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:52 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32276-RA | 213..404 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:52 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3198322..3198431 | 101..210 | 98 | <- | Minus |
3L | 3198752..3198835 | 17..100 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:37:32 Download gff for
BO16075.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3198322..3198431 | 101..210 | 98 | <- | Minus |
arm_3L | 3198752..3198835 | 17..100 | 100 | | Minus |
BO16075.pep Sequence
Translation from 16 to 226
> BO16075.pep
MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVC
GSAIFQIVQSIRAAASFLDH
BO16075.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32276-PB | 64 | CG32276-PB | 1..64 | 1..64 | 327 | 100 | Plus |
CG32276-PA | 64 | CG32276-PA | 1..64 | 1..64 | 327 | 100 | Plus |