Clone Sequence Records
BO16083.5prime Sequence
212 bp (212 high quality bases) assembled on 2006-06-16
> BO16083.5prime
GAAGTTATCAGTCGACATGCAGGTGCTAGGCGGCAATCCACTCAGCTTGT
GTCTCTTGGTGATCATCACTCCGTCACTGATTGCAGCCAATCCCCTGTGG
AGTCTTGACCAGGTGGGAGCATACTTCACTGGCATCTTCCGCTCCGTAGT
GGGTCCAATATTTGGCTTTGGCCTGGCAGCCAACAGCACCGCCTTAGCAA
GCTTTCTAGACC
BO16083.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:34:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG30033-PB | 183 | CG30033-RB | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:32:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG30033-RC | 572 | CG30033-RC | 18..197 | 17..196 | 900 | 100 | Plus |
| CG30033-RB | 1002 | CG30033-RB | 18..197 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:32:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 11292548..11292650 | 17..119 | 515 | 100 | Plus |
| 2R | 25286936 | 2R | 11292708..11292786 | 118..196 | 395 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:32:43 has no hits.
BO16083.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:03 Download gff for
BO16083.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-PB | 1..183 | 17..200 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:30:37 Download gff for
BO16083.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 18..205 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:54:25 Download gff for
BO16083.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 18..205 | 17..204 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:54:25 Download gff for
BO16083.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11292548..11292650 | 17..119 | 100 | -> | Plus |
| 2R | 11292710..11292794 | 120..204 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:30:37 Download gff for
BO16083.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 7180053..7180155 | 17..119 | 100 | -> | Plus |
| arm_2R | 7180215..7180299 | 120..204 | 96 | | Plus |
BO16083.complete Sequence
214 bp assembled on 2008-08-15
GenBank Submission: FJ633712
> BO16083.complete
GAAGTTATCAGTCGACATGCAGGTGCTAGGCGGCAATCCACTCAGCTTGT
GTCTCTTGGTGATCATCACTCCGTCACTGATTGCAGCCAATCCCCTGTGG
AGTCTTGACCAGGTGGGAGCATACTTCACTGGCATCTTCCGCTCCGTAGT
GGGTCCAATATTTGGCTTTGGCCTGGCAGCCAACAGCACCGCCTTAGCAA
GCTTTCTAGACCAT
BO16083.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:19:47
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG30033-RC | 183 | CG30033-PC | 1..180 | 17..196 | 900 | 100 | Plus |
| CG30033-RB | 183 | CG30033-PB | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:19:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG30033-RC | 572 | CG30033-RC | 18..197 | 17..196 | 900 | 100 | Plus |
| CG30033-RB | 1002 | CG30033-RB | 18..197 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:19:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 11292548..11292650 | 17..119 | 515 | 100 | Plus |
| 2R | 25286936 | 2R | 11292708..11292786 | 118..196 | 395 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:19:46 has no hits.
BO16083.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:38 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 21..208 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:29:50 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 18..197 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:16:42 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 21..200 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:55 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG30033-RB | 18..197 | 17..198 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:55 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 11292548..11292650 | 17..119 | 100 | -> | Plus |
| 2R | 11292710..11292786 | 120..198 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:29:50 Download gff for
BO16083.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 7180053..7180155 | 17..119 | 100 | -> | Plus |
| arm_2R | 7180215..7180291 | 120..198 | 97 | | Plus |
BO16083.pep Sequence
Translation from 16 to 214
> BO16083.pep
MQVLGGNPLSLCLLVIITPSLIAANPLWSLDQVGAYFTGIFRSVVGPIFG
FGLAANSTALASFLDH
BO16083.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:19:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG30033-PC | 60 | CG30033-PC | 1..60 | 1..60 | 304 | 100 | Plus |
| CG30033-PB | 60 | CG30033-PB | 1..60 | 1..60 | 304 | 100 | Plus |
