Clone BO16108 Report

Search the DGRC for BO16108

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG32667-RA
Protein status:BO16108.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO16108.5prime Sequence

296 bp (296 high quality bases) assembled on 2006-06-16

> BO16108.5prime
GAAGTTATCAGTCGACATGAAATCGGTCACGTTCGTACTCTGCCTGCTCG
TTCTGGGCGCCCACTCGCTGCTGGTGTTCGCCGTGGATTGCGAGATCGGT
GGGCATCAGTTCAAGACCGGAGAGAAGTACACGCCGGAAGGTCGCTGCCT
GCAGTACACCTGCCAGGCACCCAAACAGGTGACTGCCTTGGGATGCCCGG
CCATCGCCTCCTTGAAGCCCTGCAAAATGGAAGAGGATCTGAGCAAACCC
TATCCCGGCTGCTGTCCCAAGTTCAACTGCGCAAGCTTTCTAGACC

BO16108.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG32667-PA 267 CG32667-RA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 368 CG32667-RA 20..283 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140001..11140110 192..83 550 100 Minus
X 23542271 X 11139847..11139935 280..192 445 100 Minus
X 23542271 X 11140178..11140244 83..17 335 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:09:18 has no hits.

BO16108.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:23 Download gff for BO16108.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-PA 1..267 17..283 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 06:19:09 Download gff for BO16108.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..289 9..284 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:30:46 Download gff for BO16108.5prime
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 14..289 9..284 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:30:46 Download gff for BO16108.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11139841..11139934 193..284 97 <- Minus
X 11140001..11140109 84..192 100 <- Minus
X 11140178..11140250 9..83 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 06:19:09 Download gff for BO16108.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11033874..11033967 193..284 97 <- Minus
arm_X 11034034..11034142 84..192 100 <- Minus
arm_X 11034211..11034283 9..83 94   Minus

BO16108.complete Sequence

298 bp assembled on 2008-08-15

GenBank Submission: FJ633719

> BO16108.complete
GAAGTTATCAGTCGACATGAAATCGGTCACGTTCGTACTCTGCCTGCTCG
TTCTGGGCGCCCACTCGCTGCTGGTGTTCGCCGTGGATTGCGAGATCGGT
GGGCATCAGTTCAAGACCGGAGAGAAGTACACGCCGGAAGGTCGCTGCCT
GCAGTACACCTGCCAGGCACCCAAACAGGTGACTGCCTTGGGATGCCCGG
CCATCGCCTCCTTGAAGCCCTGCAAAATGGAAGAGGATCTGAGCAAACCC
TATCCCGGCTGCTGTCCCAAGTTCAACTGCGCAAGCTTTCTAGACCAT

BO16108.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 267 CG32667-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 368 CG32667-RA 20..283 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140001..11140110 192..83 550 100 Minus
X 23542271 X 11139847..11139935 280..192 445 100 Minus
X 23542271 X 11140178..11140244 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:08:51 has no hits.

BO16108.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:44:19 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..289 9..284 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:40:20 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 20..283 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:10:00 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 20..283 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:45:45 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 20..283 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:45:45 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
X 11139843..11139934 193..282 97 <- Minus
X 11140001..11140109 84..192 100 <- Minus
X 11140178..11140244 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:40:20 Download gff for BO16108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11034211..11034277 17..83 100   Minus
arm_X 11033876..11033967 193..282 97 <- Minus
arm_X 11034034..11034142 84..192 100 <- Minus

BO16108.pep Sequence

Translation from 16 to 298

> BO16108.pep
MKSVTFVLCLLVLGAHSLLVFAVDCEIGGHQFKTGEKYTPEGRCLQYTCQ
APKQVTALGCPAIASLKPCKMEEDLSKPYPGCCPKFNCASFLDH

BO16108.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-PA 88 CG32667-PA 1..88 1..88 488 100 Plus