Clone BO16112 Report

Search the DGRC for BO16112

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG15282-RA
Protein status:BO16112.pep: Inserted from web
Sequenced Size:271

Clone Sequence Records

BO16112.complete Sequence

271 bp assembled on 2008-10-22

GenBank Submission: KX795490

> BO16112.complete
GAAGTTATCAGTCGACATGAAATTCTTGGTGATCGTTTTTGTGGCCCTTA
TCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAGGATTCGGTGGA
TTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGATTCGGCGGTTT
CGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTTCGGTGGATTCG
GCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAACAAGGAGGCTTC
TTCGCAAGCTTTCTAGACCAT

BO16112.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 240 CG15282-PB 1..237 17..253 1185 100 Plus
CG15282-RC 240 CG15282-PC 1..237 17..253 1185 100 Plus
CG15282-RA 240 CG15282-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RB 383 CG15282-RB 78..314 17..253 1185 100 Plus
CG15282-RC 521 CG15282-RC 216..452 17..253 1185 100 Plus
CG15282-RA 563 CG15282-RA 78..314 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713049 28..253 1130 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:46:09 has no hits.

BO16112.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:06 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 73..325 12..265 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:58:54 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 78..314 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-22 16:56:13 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 78..314 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:07:57 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 78..314 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:07:57 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712819..14713049 22..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:58:54 Download gff for BO16112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14712819..14713049 22..255 98   Plus

BO16112.pep Sequence

Translation from 16 to 271

> BO16112.pep
MKFLVIVFVALIAVASALPQFGYGGFGGFGGFGGQQQQQEGFGGFGGFGE
QQQQQESFGGFGGFGGIEQQQQQQQGGFFASFLDH

BO16112.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PB 79 CG15282-PB 1..79 1..79 420 100 Plus
CG15282-PC 79 CG15282-PC 1..79 1..79 420 100 Plus
CG15282-PA 79 CG15282-PA 1..79 1..79 420 100 Plus
CG4440-PB 79 CG4440-PB 1..74 1..78 228 66.7 Plus
CG4440-PA 79 CG4440-PA 1..74 1..78 228 66.7 Plus