Clone Sequence Records
BO16115.5prime Sequence
221 bp (221 high quality bases) assembled on 2006-06-16
> BO16115.5prime
GAAGTTATCAGTCGACATGAACTTCTACAAGATCTTCGTTTTCGTCGCCC
TCATCCTGGCCATCAGCATTGGACAATCGGAAGCCGGTTGGCTGAAGAAA
CTTGGCAAGAGAATCGAGCGCATTGGCCAGCACACCCGGGATGCAACCAT
TCAAGGACTGGGAATTGCGCAACAGGCCGCCAATGTGGCAGCCACCGCCA
GAGGAGCAAGCTTTCTAGACC
BO16115.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG1373-PA | 192 | CecC-RA | 1..189 | 17..205 | 945 | 100 | Plus |
| CG1365-PA | 192 | CecA1-RA | 1..170 | 17..186 | 375 | 88.8 | Plus |
| CG1367-PA | 192 | CecA2-RA | 1..101 | 17..117 | 305 | 92 | Plus |
| CG1367-PA | 192 | CecA2-RA | 139..179 | 155..195 | 130 | 92.6 | Plus |
| CG1878-PA | 192 | CecB-RA | 1..51 | 17..67 | 130 | 90.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:49:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecC-RA | 386 | CG1373-RA | 93..282 | 16..205 | 950 | 100 | Plus |
| CecA1-RA | 339 | CG1365-RA | 74..262 | 16..204 | 585 | 87.3 | Plus |
| CecA2-RA | 355 | CG1367-RA | 82..261 | 16..195 | 570 | 87.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:49:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 30216576..30216676 | 16..116 | 505 | 100 | Plus |
| 3R | 32079331 | 3R | 30216745..30216834 | 116..205 | 450 | 100 | Plus |
| 3R | 32079331 | 3R | 30212237..30212337 | 16..116 | 385 | 92.1 | Plus |
| 3R | 32079331 | 3R | 30210947..30211047 | 16..116 | 385 | 92.1 | Plus |
| 3R | 32079331 | 3R | 30213626..30213730 | 116..12 | 225 | 81 | Minus |
| 3R | 32079331 | 3R | 30211111..30211196 | 119..204 | 205 | 82.6 | Plus |
| 3R | 32079331 | 3R | 30212402..30212474 | 123..195 | 200 | 84.9 | Plus |
| 3R | 32079331 | 3R | 30213486..30213565 | 198..119 | 190 | 82.5 | Minus |
Blast to na_te.dros performed on 2015-02-12 18:49:06 has no hits.
BO16115.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:26 Download gff for
BO16115.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG1373-PA | 1..192 | 17..208 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:24:18 Download gff for
BO16115.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 89..290 | 12..214 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:34:25 Download gff for
BO16115.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 89..290 | 12..214 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:34:25 Download gff for
BO16115.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 30216572..30216675 | 12..115 | 98 | -> | Plus |
| 3R | 30216745..30216842 | 116..214 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:24:18 Download gff for
BO16115.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 26042294..26042397 | 12..115 | 98 | -> | Plus |
| arm_3R | 26042467..26042564 | 116..214 | 96 | | Plus |
BO16115.complete Sequence
223 bp assembled on 2008-08-15
GenBank Submission: FJ633721
> BO16115.complete
GAAGTTATCAGTCGACATGAACTTCTACAAGATCTTCGTTTTCGTCGCCC
TCATCCTGGCCATCAGCATTGGACAATCGGAAGCCGGTTGGCTGAAGAAA
CTTGGCAAGAGAATCGAGCGCATTGGCCAGCACACCCGGGATGCAACCAT
TCAAGGACTGGGAATTGCGCAACAGGCCGCCAATGTGGCAGCCACCGCCA
GAGGAGCAAGCTTTCTAGACCAT
BO16115.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:26:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecC-RA | 192 | CG1373-PA | 1..189 | 17..205 | 945 | 100 | Plus |
| CecA1-RA | 192 | CG1365-PA | 1..188 | 17..204 | 580 | 87.2 | Plus |
| CecA2-RA | 192 | CG1367-PA | 1..179 | 17..195 | 565 | 87.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:26:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecC-RA | 386 | CG1373-RA | 93..282 | 16..205 | 950 | 100 | Plus |
| CecA1-RA | 339 | CG1365-RA | 74..262 | 16..204 | 585 | 87.3 | Plus |
| CecA2-RA | 355 | CG1367-RA | 82..261 | 16..195 | 570 | 87.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:26:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 30216576..30216676 | 16..116 | 505 | 100 | Plus |
| 3R | 32079331 | 3R | 30216745..30216834 | 116..205 | 450 | 100 | Plus |
| 3R | 32079331 | 3R | 30210947..30211047 | 16..116 | 385 | 92.1 | Plus |
| 3R | 32079331 | 3R | 30212237..30212337 | 16..116 | 385 | 92.1 | Plus |
| 3R | 32079331 | 3R | 30213626..30213730 | 116..12 | 225 | 81 | Minus |
| 3R | 32079331 | 3R | 30211111..30211196 | 119..204 | 205 | 82.6 | Plus |
| 3R | 32079331 | 3R | 30212402..30212474 | 123..195 | 200 | 84.9 | Plus |
| 3R | 32079331 | 3R | 30213486..30213565 | 198..119 | 190 | 82.5 | Minus |
Blast to na_te.dros performed on 2014-11-27 20:26:28 has no hits.
BO16115.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:08 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 89..290 | 12..214 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:10:02 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 94..282 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:00:34 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 94..282 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:21:29 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecC-RA | 94..282 | 17..207 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:21:29 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 30216577..30216675 | 17..115 | 100 | -> | Plus |
| 3R | 30216745..30216834 | 116..207 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:10:02 Download gff for
BO16115.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 26042299..26042397 | 17..115 | 100 | -> | Plus |
| arm_3R | 26042467..26042556 | 116..207 | 97 | | Plus |
BO16115.pep Sequence
Translation from 16 to 223
> BO16115.pep
MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATARGASFLDH
BO16115.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:40:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 311 | 100 | Plus |
| CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
| CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
| CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 276 | 88.9 | Plus |
