Clone BO16117 Report

Search the DGRC for BO16117

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG6610-RA
Protein status:BO16117.pep: Imported from assembly
Sequenced Size:307

Clone Sequence Records

BO16117.5prime Sequence

305 bp (305 high quality bases) assembled on 2006-06-16

> BO16117.5prime
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGGCAAGCTTTCT
AGACC

BO16117.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PA 276 CG6610-RA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 14:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 103..377 15..289 1375 100 Plus
CG6610-RB 421 CG6610-RB 103..377 15..289 1375 100 Plus
CG6610-RA 586 CG6610-RA 103..377 15..289 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 14:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 65..266 995 99.5 Plus
3L 28110227 3L 6075638..6075688 15..65 255 100 Plus
Blast to na_te.dros performed on 2015-02-10 14:38:09 has no hits.

BO16117.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:26 Download gff for BO16117.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-PA 1..276 17..290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 17:02:43 Download gff for BO16117.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 6..297 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:45:59 Download gff for BO16117.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 6..297 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:45:59 Download gff for BO16117.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6075631..6075688 6..65 93 -> Plus
3L 6075761..6075957 66..262 100 -> Plus
3L 6076023..6076059 263..297 91   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 17:02:43 Download gff for BO16117.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6068861..6069057 66..262 100 -> Plus
arm_3L 6068731..6068788 6..65 93 -> Plus
arm_3L 6069123..6069159 263..297 91   Plus

BO16117.complete Sequence

307 bp assembled on 2008-08-15

GenBank Submission: FJ633722

> BO16117.complete
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGGCAAGCTTTCT
AGACCAT

BO16117.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 276 CG6610-PC 1..273 17..289 1365 100 Plus
CG6610-RB 276 CG6610-PB 1..273 17..289 1365 100 Plus
CG6610-RA 276 CG6610-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 103..377 15..289 1375 100 Plus
CG6610-RB 421 CG6610-RB 103..377 15..289 1375 100 Plus
CG6610-RA 586 CG6610-RA 103..377 15..289 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 65..266 995 99.5 Plus
3L 28110227 3L 6075638..6075688 15..65 255 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:41:14 has no hits.

BO16117.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:31 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 95..386 6..297 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:40 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 105..377 17..291 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:08:27 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 104..376 17..291 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:54 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 105..377 17..291 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:54 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6075761..6075957 66..262 100 -> Plus
3L 6076023..6076049 263..291 93   Plus
3L 6075640..6075688 17..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:40 Download gff for BO16117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6068740..6068788 17..65 100 -> Plus
arm_3L 6068861..6069057 66..262 100 -> Plus
arm_3L 6069123..6069149 263..291 93   Plus

BO16117.pep Sequence

Translation from 16 to 307

> BO16117.pep
MTAVPPPSNISTLMPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNM
LLDDVTEYENTPDGRRITKLDQILLNGNNITMLVPGGELAEASFLDH

BO16117.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PC 91 CG6610-PC 1..91 1..91 469 100 Plus
CG6610-PB 91 CG6610-PB 1..91 1..91 469 100 Plus
CG6610-PA 91 CG6610-PA 1..91 1..91 469 100 Plus