Clone Sequence Records
BO16117.5prime Sequence
305 bp (305 high quality bases) assembled on 2006-06-16
> BO16117.5prime
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGGCAAGCTTTCT
AGACC
BO16117.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6610-PA | 276 | CG6610-RA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 14:38:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6610-RC | 520 | CG6610-RC | 103..377 | 15..289 | 1375 | 100 | Plus |
CG6610-RB | 421 | CG6610-RB | 103..377 | 15..289 | 1375 | 100 | Plus |
CG6610-RA | 586 | CG6610-RA | 103..377 | 15..289 | 1375 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 14:38:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 6075760..6075961 | 65..266 | 995 | 99.5 | Plus |
3L | 28110227 | 3L | 6075638..6075688 | 15..65 | 255 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 14:38:09 has no hits.
BO16117.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:26 Download gff for
BO16117.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-PA | 1..276 | 17..290 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 17:02:43 Download gff for
BO16117.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 96..387 | 6..297 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:45:59 Download gff for
BO16117.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 96..387 | 6..297 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:45:59 Download gff for
BO16117.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 6075631..6075688 | 6..65 | 93 | -> | Plus |
3L | 6075761..6075957 | 66..262 | 100 | -> | Plus |
3L | 6076023..6076059 | 263..297 | 91 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 17:02:43 Download gff for
BO16117.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 6068861..6069057 | 66..262 | 100 | -> | Plus |
arm_3L | 6068731..6068788 | 6..65 | 93 | -> | Plus |
arm_3L | 6069123..6069159 | 263..297 | 91 | | Plus |
BO16117.complete Sequence
307 bp assembled on 2008-08-15
GenBank Submission: FJ633722
> BO16117.complete
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGGCAAGCTTTCT
AGACCAT
BO16117.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6610-RC | 276 | CG6610-PC | 1..273 | 17..289 | 1365 | 100 | Plus |
CG6610-RB | 276 | CG6610-PB | 1..273 | 17..289 | 1365 | 100 | Plus |
CG6610-RA | 276 | CG6610-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6610-RC | 520 | CG6610-RC | 103..377 | 15..289 | 1375 | 100 | Plus |
CG6610-RB | 421 | CG6610-RB | 103..377 | 15..289 | 1375 | 100 | Plus |
CG6610-RA | 586 | CG6610-RA | 103..377 | 15..289 | 1375 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:41:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 6075760..6075961 | 65..266 | 995 | 99.5 | Plus |
3L | 28110227 | 3L | 6075638..6075688 | 15..65 | 255 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:41:14 has no hits.
BO16117.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:31 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 95..386 | 6..297 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:40 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 105..377 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:08:27 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 104..376 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:54 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6610-RA | 105..377 | 17..291 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:54 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 6075761..6075957 | 66..262 | 100 | -> | Plus |
3L | 6076023..6076049 | 263..291 | 93 | | Plus |
3L | 6075640..6075688 | 17..65 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:40 Download gff for
BO16117.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 6068740..6068788 | 17..65 | 100 | -> | Plus |
arm_3L | 6068861..6069057 | 66..262 | 100 | -> | Plus |
arm_3L | 6069123..6069149 | 263..291 | 93 | | Plus |
BO16117.pep Sequence
Translation from 16 to 307
> BO16117.pep
MTAVPPPSNISTLMPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNM
LLDDVTEYENTPDGRRITKLDQILLNGNNITMLVPGGELAEASFLDH
BO16117.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:28:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6610-PC | 91 | CG6610-PC | 1..91 | 1..91 | 469 | 100 | Plus |
CG6610-PB | 91 | CG6610-PB | 1..91 | 1..91 | 469 | 100 | Plus |
CG6610-PA | 91 | CG6610-PA | 1..91 | 1..91 | 469 | 100 | Plus |