BO16118.complete Sequence
244 bp assembled on 2009-08-24
GenBank Submission: KX795785
> BO16118.complete
GAAGTTATCAGTCGACATGCCACGGGAAATTAAAGAAGTTAAAGATTTTC
TTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAAAAATCAAGAAAAAT
CCCACTAACACCAAATTTAAGATCCGTTGTTCGAGGTTCCTTTACACCCT
TGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAAGCAGTCTTTACCGC
CTGGACTACAAGTAAAGGAGGTGAAAGCAAGCTTTCTAGACCAT
BO16118.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-RA | 213 | CG18001-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
RpL38-RB | 213 | CG18001-PB | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-RA | 401 | CG18001-RA | 82..291 | 17..226 | 1050 | 100 | Plus |
RpL38-RB | 1013 | CG18001-RB | 82..291 | 17..226 | 1050 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 4516110..4516319 | 226..17 | 1050 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 01:07:20 has no hits.
BO16118.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 11:38:18 Download gff for
BO16118.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 80..289 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:34 Download gff for
BO16118.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 82..291 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:58 Download gff for
BO16118.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 82..291 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:58 Download gff for
BO16118.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4516108..4516319 | 17..228 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:34 Download gff for
BO16118.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 403613..403824 | 17..228 | 99 | | Minus |
BO16118.pep Sequence
Translation from 16 to 244
> BO16118.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVKASFLDH
BO16118.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-PA | 70 | CG18001-PA | 1..70 | 1..70 | 353 | 100 | Plus |
RpL38-PB | 70 | CG18001-PB | 1..70 | 1..70 | 353 | 100 | Plus |