Clone BO16118 Report

Search the DGRC for BO16118

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptRpL38-RA
Protein status:BO16118.pep: Imported from assembly
Sequenced Size:244

Clone Sequence Records

BO16118.complete Sequence

244 bp assembled on 2009-08-24

GenBank Submission: KX795785

> BO16118.complete
GAAGTTATCAGTCGACATGCCACGGGAAATTAAAGAAGTTAAAGATTTTC
TTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAAAAATCAAGAAAAAT
CCCACTAACACCAAATTTAAGATCCGTTGTTCGAGGTTCCTTTACACCCT
TGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAAGCAGTCTTTACCGC
CTGGACTACAAGTAAAGGAGGTGAAAGCAAGCTTTCTAGACCAT

BO16118.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-RA 213 CG18001-PA 1..210 17..226 1050 100 Plus
RpL38-RB 213 CG18001-PB 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-RA 401 CG18001-RA 82..291 17..226 1050 100 Plus
RpL38-RB 1013 CG18001-RB 82..291 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4516110..4516319 226..17 1050 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:07:20 has no hits.

BO16118.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 11:38:18 Download gff for BO16118.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 80..289 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:34 Download gff for BO16118.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 82..291 17..228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:58 Download gff for BO16118.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 82..291 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:58 Download gff for BO16118.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4516108..4516319 17..228 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:34 Download gff for BO16118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 403613..403824 17..228 99   Minus

BO16118.pep Sequence

Translation from 16 to 244

> BO16118.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVKASFLDH

BO16118.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-PA 70 CG18001-PA 1..70 1..70 353 100 Plus
RpL38-PB 70 CG18001-PB 1..70 1..70 353 100 Plus