Clone BO16123 Report

Search the DGRC for BO16123

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG9034-RA
Protein status:BO16123.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO16123.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-06-16

> BO16123.5prime
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACGCA
AGCTTTCTAGACC

BO16123.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PA 234 CG9034-RA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 481 CG9034-RB 156..386 17..247 1155 100 Plus
CG9034-RA 386 CG9034-RA 61..291 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159609..9159839 247..17 1155 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:33:13 has no hits.

BO16123.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:29 Download gff for BO16123.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-PA 1..234 17..248 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:19:13 Download gff for BO16123.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..291 17..247 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:05 Download gff for BO16123.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..291 17..247 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:05 Download gff for BO16123.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9159609..9159839 17..247 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:19:13 Download gff for BO16123.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053642..9053872 17..247 100   Minus

BO16123.complete Sequence

265 bp assembled on 2008-08-15

GenBank Submission: FJ633723

> BO16123.complete
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACGCA
AGCTTTCTAGACCAT

BO16123.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 234 CG9034-PB 1..231 17..247 1155 100 Plus
CG9034-RA 234 CG9034-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 481 CG9034-RB 156..386 17..247 1155 100 Plus
CG9034-RA 386 CG9034-RA 61..291 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159609..9159839 247..17 1155 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:35:02 has no hits.

BO16123.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:56 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 89..319 17..247 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:55:07 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..291 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:23:50 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 89..319 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:02 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..291 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:02 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
X 9159607..9159839 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:55:07 Download gff for BO16123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053640..9053872 17..249 99   Minus

BO16123.pep Sequence

Translation from 16 to 265

> BO16123.pep
MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD
NRRYKLGYVVYRHDDPRALKVRNDEDDASFLDH

BO16123.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PB 77 CG9034-PB 1..77 1..77 395 100 Plus
CG9034-PA 77 CG9034-PA 1..77 1..77 395 100 Plus