Clone Sequence Records
BO16123.5prime Sequence
263 bp (263 high quality bases) assembled on 2006-06-16
> BO16123.5prime
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACGCA
AGCTTTCTAGACC
BO16123.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:36:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-PA | 234 | CG9034-RA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:33:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 481 | CG9034-RB | 156..386 | 17..247 | 1155 | 100 | Plus |
CG9034-RA | 386 | CG9034-RA | 61..291 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:33:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9159609..9159839 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 11:33:13 has no hits.
BO16123.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:29 Download gff for
BO16123.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-PA | 1..234 | 17..248 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:19:13 Download gff for
BO16123.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..291 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:05 Download gff for
BO16123.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..291 | 17..247 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:05 Download gff for
BO16123.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9159609..9159839 | 17..247 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:19:13 Download gff for
BO16123.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9053642..9053872 | 17..247 | 100 | | Minus |
BO16123.complete Sequence
265 bp assembled on 2008-08-15
GenBank Submission: FJ633723
> BO16123.complete
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACGCA
AGCTTTCTAGACCAT
BO16123.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:35:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 234 | CG9034-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
CG9034-RA | 234 | CG9034-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:35:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 481 | CG9034-RB | 156..386 | 17..247 | 1155 | 100 | Plus |
CG9034-RA | 386 | CG9034-RA | 61..291 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:35:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9159609..9159839 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:35:02 has no hits.
BO16123.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:56 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 89..319 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:55:07 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..291 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:23:50 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 89..319 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:02 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..291 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:02 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9159607..9159839 | 17..249 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:55:07 Download gff for
BO16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9053640..9053872 | 17..249 | 99 | | Minus |
BO16123.pep Sequence
Translation from 16 to 265
> BO16123.pep
MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD
NRRYKLGYVVYRHDDPRALKVRNDEDDASFLDH
BO16123.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:42:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-PB | 77 | CG9034-PB | 1..77 | 1..77 | 395 | 100 | Plus |
CG9034-PA | 77 | CG9034-PA | 1..77 | 1..77 | 395 | 100 | Plus |