Clone BO16133 Report

Search the DGRC for BO16133

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG17298-RA
Protein status:BO16133.pep: Imported from assembly
Sequenced Size:319

Clone Sequence Records

BO16133.5prime Sequence

317 bp (317 high quality bases) assembled on 2006-06-16

> BO16133.5prime
GAAGTTATCAGTCGACATGTTCAAAGTACTGTTCGTGCTCGCCGCCTTCG
TCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCCGTGGCACCCGTG
GTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCATCATGGAGCCCA
CTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCGTCAAGGTCATCA
CACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCTGTCAGGCCGGTG
GTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGTCGTCGTGCATCA
TGCAAGCTTTCTAGACC

BO16133.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 288 CG17298-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 18:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 495 CG17298-RA 79..363 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 18:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21283918 163..301 695 100 Plus
3R 32079331 3R 21283584..21283717 29..162 670 100 Plus
Blast to na_te.dros performed on 2015-01-30 18:07:34 has no hits.

BO16133.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:34 Download gff for BO16133.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-PA 1..288 17..305 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 19:16:28 Download gff for BO16133.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..367 12..306 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 19:36:17 Download gff for BO16133.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..367 12..306 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 19:36:17 Download gff for BO16133.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21283780..21283922 163..306 98   Plus
3R 21283584..21283717 29..162 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 19:16:28 Download gff for BO16133.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17109306..17109439 29..162 100 -> Plus
arm_3R 17109502..17109644 163..306 98   Plus

BO16133.complete Sequence

319 bp assembled on 2008-08-15

GenBank Submission: FJ633724

> BO16133.complete
GAAGTTATCAGTCGACATGTTCAAAGTACTGTTCGTGCTCGCCGCCTTCG
TCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCCGTGGCACCCGTG
GTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCATCATGGAGCCCA
CTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCGTCAAGGTCATCA
CACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCTGTCAGGCCGGTG
GTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGTCGTCGTGCATCA
TGCAAGCTTTCTAGACCAT

BO16133.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 288 CG17298-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 495 CG17298-RA 79..363 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21283918 163..301 695 100 Plus
3R 32079331 3R 21283584..21283717 29..162 670 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:18:55 has no hits.

BO16133.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:07:35 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..367 12..306 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:28 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 84..363 22..303 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:20:27 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 84..363 22..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:15:38 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 84..363 22..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:15:38 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21283579..21283717 22..162 97 -> Plus
3R 21283780..21283918 163..303 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:28 Download gff for BO16133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17109301..17109439 22..162 97 -> Plus
arm_3R 17109502..17109640 163..303 98   Plus

BO16133.pep Sequence

Translation from 16 to 319

> BO16133.pep
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHHASFLD
H

BO16133.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 95 CG17298-PA 1..95 1..95 495 100 Plus