Clone Sequence Records
BO16141.5prime Sequence
140 bp (140 high quality bases) assembled on 2006-06-16
> BO16141.5prime
GAAGTTATCAGTCGACATGGCCGGGAAAAACCGAAGCCAGAAACGGAGAT
TATATTCCACTGCAAGATTGGCAAAAGAAGCCTTAAGGCTGCAGAAGCTG
CCGCCGCATTGGGATTCAAGAATGGCAAGCTTTCTAGACC
BO16141.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:37:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG6000-PA | 447 | CG6000-RA | 281..388 | 17..124 | 540 | 100 | Plus |
| CG6000-PB | 111 | CG6000-RB | 1..108 | 17..124 | 540 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 08:25:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG6000-RC | 644 | CG6000-RC | 403..510 | 17..124 | 540 | 100 | Plus |
| CG6000-RD | 702 | CG6000-RD | 403..510 | 17..124 | 540 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 08:25:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 24054793..24054900 | 17..124 | 540 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 08:25:58 has no hits.
BO16141.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:39 Download gff for
BO16141.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-PB | 1..111 | 17..128 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 14:55:34 Download gff for
BO16141.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-RD | 403..515 | 17..129 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:58:17 Download gff for
BO16141.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-RD | 403..515 | 17..129 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:58:17 Download gff for
BO16141.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 24054793..24054905 | 17..129 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 14:55:34 Download gff for
BO16141.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 19880515..19880627 | 17..129 | 98 | | Plus |
BO16141.complete Sequence
142 bp assembled on 2009-08-24
GenBank Submission: KX794616
> BO16141.complete
GAAGTTATCAGTCGACATGGCCGGGAAAAACCGAAGCCAGAAACGGAGAT
TATATTCCACTGCAAGATTGGCAAAAGAAGCCTTAAGGCTGCAGAAGCTG
CCGCCGCATTGGGATTCAAGAATGGCAAGCTTTCTAGACCAT
BO16141.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:05:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG6000-RC | 465 | CG6000-PC | 299..406 | 17..124 | 540 | 100 | Plus |
| CG6000-RD | 465 | CG6000-PD | 299..406 | 17..124 | 540 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:05:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG6000-RC | 644 | CG6000-RC | 403..510 | 17..124 | 540 | 100 | Plus |
| CG6000-RD | 702 | CG6000-RD | 403..510 | 17..124 | 540 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:05:51
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 24054793..24054900 | 17..124 | 540 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:05:52 has no hits.
BO16141.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 12:18:34 Download gff for
BO16141.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-RA | 281..388 | 17..126 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:44:51 Download gff for
BO16141.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-RD | 403..510 | 17..126 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:25 Download gff for
BO16141.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG6000-RD | 403..510 | 17..126 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:25 Download gff for
BO16141.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 24054793..24054900 | 17..126 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:44:51 Download gff for
BO16141.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 19880515..19880622 | 17..126 | 98 | | Plus |
BO16141.pep Sequence
Translation from 16 to 142
> BO16141.pep
MAGKNRSQKRRLYSTARLAKEALRLQKLPPHWDSRMASFLDH
Sequence BO16141.pep has no blast hits.
