Clone BO16172 Report

Search the DGRC for BO16172

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:161
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptSrp9-RA
Protein status:BO16172.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO16172.complete Sequence

265 bp assembled on 2010-04-12

GenBank Submission: KX798565

> BO16172.complete
GAAGTTATCAGTCGACATGGTTTTTGTAAAGAACTGGGATGATTTCGAGA
TTGCCGTCGAGAACATGTACTTGGCCAATCCACAGAACTGTCGACTTACC
ATGAAATACGCGCACTCCAAGGGCCACATTCTGCTAAAAATGACGGACAA
CGTTAAGTGTGTGCAGTACAAAGCGGAGAACATGCCGGATCTCAGAAAAA
TCGAGAAGATCACCAGCAACTTGGTGGGACACATGGCGTCCAAGGAAGCA
AGCTTTCTAGACCAT

BO16172.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-RA 234 CG8268-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-RA 821 CG8268-RA 103..333 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7936475..7936615 17..157 705 100 Plus
3L 28110227 3L 7936679..7936770 156..247 460 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:37:47 has no hits.

BO16172.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:23:33 Download gff for BO16172.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 101..331 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:30 Download gff for BO16172.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 103..333 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:46 Download gff for BO16172.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 103..333 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:46 Download gff for BO16172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7936475..7936615 17..157 100 -> Plus
3L 7936681..7936770 158..249 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:30 Download gff for BO16172.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7929575..7929715 17..157 100 -> Plus
arm_3L 7929781..7929870 158..249 97   Plus

BO16172.pep Sequence

Translation from 16 to 265

> BO16172.pep
MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQ
YKAENMPDLRKIEKITSNLVGHMASKEASFLDH

BO16172.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-PA 77 CG8268-PA 1..77 1..77 409 100 Plus