BO16172.complete Sequence
265 bp assembled on 2010-04-12
GenBank Submission: KX798565
> BO16172.complete
GAAGTTATCAGTCGACATGGTTTTTGTAAAGAACTGGGATGATTTCGAGA
TTGCCGTCGAGAACATGTACTTGGCCAATCCACAGAACTGTCGACTTACC
ATGAAATACGCGCACTCCAAGGGCCACATTCTGCTAAAAATGACGGACAA
CGTTAAGTGTGTGCAGTACAAAGCGGAGAACATGCCGGATCTCAGAAAAA
TCGAGAAGATCACCAGCAACTTGGTGGGACACATGGCGTCCAAGGAAGCA
AGCTTTCTAGACCAT
BO16172.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:37:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Srp9-RA | 234 | CG8268-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:37:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Srp9-RA | 821 | CG8268-RA | 103..333 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:37:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7936475..7936615 | 17..157 | 705 | 100 | Plus |
3L | 28110227 | 3L | 7936679..7936770 | 156..247 | 460 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:37:47 has no hits.
BO16172.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:23:33 Download gff for
BO16172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Srp9-RA | 101..331 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:30 Download gff for
BO16172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Srp9-RA | 103..333 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:46 Download gff for
BO16172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Srp9-RA | 103..333 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:46 Download gff for
BO16172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7936475..7936615 | 17..157 | 100 | -> | Plus |
3L | 7936681..7936770 | 158..249 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:30 Download gff for
BO16172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7929575..7929715 | 17..157 | 100 | -> | Plus |
arm_3L | 7929781..7929870 | 158..249 | 97 | | Plus |
BO16172.pep Sequence
Translation from 16 to 265
> BO16172.pep
MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQ
YKAENMPDLRKIEKITSNLVGHMASKEASFLDH
BO16172.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Srp9-PA | 77 | CG8268-PA | 1..77 | 1..77 | 409 | 100 | Plus |