Clone Sequence Records
BO16173.5prime Sequence
215 bp (215 high quality bases) assembled on 2006-06-16
> BO16173.5prime
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCG
CAAGCTTTCTAGACC
BO16173.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 15:39:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG9032-PA | 186 | sun-RA | 1..183 | 17..199 | 915 | 100 | Plus |
| CG9032-PB | 174 | sun-RB | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:48:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-RA | 400 | CG9032-RA | 95..277 | 17..199 | 915 | 100 | Plus |
| sun-RB | 450 | CG9032-RB | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:48:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
| 3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2015-02-12 03:48:26 has no hits.
BO16173.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:45:58 Download gff for
BO16173.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG9032-PA | 1..186 | 17..200 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:43:13 Download gff for
BO16173.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 89..287 | 7..208 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:52:39 Download gff for
BO16173.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 89..287 | 7..208 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:52:39 Download gff for
BO16173.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:43:13 Download gff for
BO16173.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
BO16173.complete Sequence
217 bp assembled on 2008-08-15
GenBank Submission: FJ633726
> BO16173.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAATCGGAATCCG
CAAGCTTTCTAGACCAT
BO16173.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-RA | 186 | CG9032-PA | 1..183 | 17..199 | 915 | 100 | Plus |
| sun-RB | 174 | CG9032-PB | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-RA | 400 | CG9032-RA | 95..277 | 17..199 | 915 | 100 | Plus |
| sun-RB | 450 | CG9032-RB | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
| 3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:53:01 has no hits.
BO16173.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:45:07 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 71..269 | 7..208 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:53 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 95..277 | 17..201 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:02:47 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 77..259 | 17..201 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:49 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RA | 95..277 | 17..201 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:49 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 15847980..15848004 | 177..201 | 92 | <- | Minus |
| X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
| X | 15849136..15849164 | 17..45 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:53 Download gff for
BO16173.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 15742013..15742037 | 177..201 | 92 | <- | Minus |
| arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
| arm_X | 15743169..15743197 | 17..45 | 100 | | Minus |
BO16173.pep Sequence
Translation from 16 to 217
> BO16173.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAQRQTQSESASFLDH
BO16173.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-PA | 61 | CG9032-PA | 1..61 | 1..61 | 312 | 100 | Plus |
| sun-PB | 57 | CG9032-PB | 1..56 | 1..56 | 275 | 94.6 | Plus |
| CG31477-PC | 64 | CG31477-PC | 1..64 | 1..61 | 221 | 68.8 | Plus |
| CG31477-PB | 64 | CG31477-PB | 1..64 | 1..61 | 221 | 68.8 | Plus |
| CG31477-PA | 64 | CG31477-PA | 1..64 | 1..61 | 221 | 68.8 | Plus |
