Clone BO16260 Report

Search the DGRC for BO16260

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:162
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptOscp-RB
Protein status:BO16260.pep: full length peptide match
Sequenced Size:412

Clone Sequence Records

BO16260.5prime Sequence

410 bp (410 high quality bases) assembled on 2006-10-13

> BO16260.5prime
GAAGTTATCAGTCGACATGGCCACCGCTCTGAAGGAGGCATCCGAGAAGC
TCCGCTTCGCCCCGGCCACCGTCAATCTGTTGGGTCTGCTGGCTGACAAC
GGACGTCTAAAGAAGCTGGACACCGTGATCAATGCCTACAAGACCATCAT
GGCCGCACATCGCGGTGAGGTCGTCTGCGAGGTGGTCACCGCCAAGCCCT
TGGATGCGTCCCAGAGCAAGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTG
AAGGGCAACGAGTCTCTGAAGATCACTTCCCGCGTGGACCCCAGCATCAT
TGGTGGCCTGATCGTTTCCATTGGCGACAAGTACGTCGACATGAGCATTG
CCACTAAGGTCAAGCTCTACACCGATGTCATCCAGACCGCTGCCGCAAGC
TTTCTAGACC

BO16260.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4307-PA 630 Oscp-RA 249..627 16..394 1895 100 Plus
CG4307-PB 381 Oscp-RB 1..378 17..394 1890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..697 16..394 1895 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 16..241 1130 100 Plus
3R 32079331 3R 15266431..15266585 240..394 775 100 Plus
Blast to na_te.dros performed on 2015-02-12 03:59:17 has no hits.

BO16260.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:29 Download gff for BO16260.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4307-PA 245..630 10..395 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:33:12 Download gff for BO16260.5prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..697 10..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:58:06 Download gff for BO16260.5prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..697 10..394 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:58:06 Download gff for BO16260.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15266141..15266370 10..241 98 -> Plus
3R 15266433..15266585 242..394 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:33:12 Download gff for BO16260.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11091863..11092092 10..241 98 -> Plus
arm_3R 11092155..11092307 242..394 100   Plus

BO16260.3prime Sequence

410 bp (410 high quality bases) assembled on 2006-10-13

> BO16260.3prime
ATGGTCTAGAAAGCTTGCGGCAGCGGTCTGGATGACATCGGTGTAGAGCT
TGACCTTAGTGGCAATGCTCATGTCGACGTACTTGTCGCCAATGGAAACG
ATCAGGCCACCAATGATGCTGGGGTCCACGCGGGAAGTGATCTTCAGAGA
CTCGTTGCCCTTCAGGAAAGACTTAAGGGCACCCTCCAGCTGCTTGCTCT
GGGACGCATCCAAGGGCTTGGCGGTGACCACCTCGCAGACGACCTCACCG
CGATGTGCGGCCATGATGGTCTTGTAGGCATTGATCACGGTGTCCAGCTT
CTTTAGACGTCCGTTGTCAGCCAGCAGACCCAACAGATTGACGGTGGCCG
GGGCGAAGCGGAGCTTCTCGGATGCCTCCTTCAGAGCGGTGGCCATGTCG
ACTGATAACT

BO16260.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4307-PA 630 Oscp-RA 249..627 397..19 1895 100 Minus
CG4307-PB 381 Oscp-RB 1..378 396..19 1890 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..697 397..19 1895 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 397..172 1130 100 Minus
3R 32079331 3R 15266431..15266585 173..19 775 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:40:46 has no hits.

BO16260.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:47:28 Download gff for BO16260.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4307-PA 245..630 18..403 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:07:27 Download gff for BO16260.3prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..697 19..403 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:44:19 Download gff for BO16260.3prime
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 315..697 19..403 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:44:19 Download gff for BO16260.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15266141..15266370 172..403 98 -> Minus
3R 15266433..15266585 19..171 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:07:27 Download gff for BO16260.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11091863..11092092 172..403 98 -> Minus
arm_3R 11092155..11092307 19..171 100   Minus

BO16260.complete Sequence

412 bp assembled on 2006-10-11

GenBank Submission: FJ633756

> BO16260.complete
GAAGTTATCAGTCGACATGGCCACCGCTCTGAAGGAGGCATCCGAGAAGC
TCCGCTTCGCCCCGGCCACCGTCAATCTGTTGGGTCTGCTGGCTGACAAC
GGACGTCTAAAGAAGCTGGACACCGTGATCAATGCCTACAAGACCATCAT
GGCCGCACATCGCGGTGAGGTCGTCTGCGAGGTGGTCACCGCCAAGCCCT
TGGATGCGTCCCAGAGCAAGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTG
AAGGGCAACGAGTCTCTGAAGATCACTTCCCGCGTGGACCCCAGCATCAT
TGGTGGCCTGATCGTTTCCATTGGCGACAAGTACGTCGACATGAGCATTG
CCACTAAGGTCAAGCTCTACACCGATGTCATCCAGACCGCTGCCGCAAGC
TTTCTAGACCAT

BO16260.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 630 CG4307-PA 249..627 16..394 1895 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 802 CG4307-RA 319..697 16..394 1895 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15266145..15266370 16..241 1130 100 Plus
3R 32079331 3R 15266431..15266585 240..394 775 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:48:01 has no hits.

BO16260.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:15 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 245..630 10..395 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:28 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 375..757 10..394 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:22 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 320..697 17..396 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:58:15 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 375..757 10..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:04:55 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 320..697 17..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:04:55 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15266146..15266370 17..241 100 -> Plus
3R 15266433..15266585 242..396 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:22 Download gff for BO16260.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11091868..11092092 17..241 100 -> Plus
arm_3R 11092155..11092307 242..396 98   Plus

BO16260.pep Sequence

Translation from 16 to 412

> BO16260.pep
MATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRG
EVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIV
SIGDKYVDMSIATKVKLYTDVIQTAAASFLDH

BO16260.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-PA 209 CG4307-PA 84..209 1..126 611 100 Plus